TRAPPC4 Antibody

Images

 
Western Blot: TRAPPC4 Antibody [NBP2-13475] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: TRAPPC4 Antibody [NBP2-13475] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQ RDGIRVGHAVLAINGMDVNGRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRAPPC4 Protein (NBP2-13475PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAPPC4 Antibody

  • Hematopoietic stem/progenitor cell protein 172
  • PTD009
  • SBDNHSPC172
  • SYNBINDIN
  • trafficking protein particle complex 4
  • trafficking protein particle complex subunit 4
  • TRS23 homolog
  • TRS23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00821
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-17046
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56628
Species: Hu
Applications: WB
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
26520002
Species: Hu
Applications: WB, ELISA
NBP2-13475
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TRAPPC4 Antibody (NBP2-13475) (0)

There are no publications for TRAPPC4 Antibody (NBP2-13475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAPPC4 Antibody (NBP2-13475) (0)

There are no reviews for TRAPPC4 Antibody (NBP2-13475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAPPC4 Antibody (NBP2-13475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAPPC4 Products

Bioinformatics Tool for TRAPPC4 Antibody (NBP2-13475)

Discover related pathways, diseases and genes to TRAPPC4 Antibody (NBP2-13475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC4 Antibody (NBP2-13475)

Discover more about diseases related to TRAPPC4 Antibody (NBP2-13475).
 

Pathways for TRAPPC4 Antibody (NBP2-13475)

View related products by pathway.

PTMs for TRAPPC4 Antibody (NBP2-13475)

Learn more about PTMs related to TRAPPC4 Antibody (NBP2-13475).

Blogs on TRAPPC4

There are no specific blogs for TRAPPC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC4