KIF13B Antibody

Images

 
Western Blot: KIF13B Antibody [NBP1-83398] - Analysis in human kidney tissue.
Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF13B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF13B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF13B Protein (NBP1-83398PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF13B Antibody

  • GAKIN
  • GAKINkinesin 13B
  • guanylate kinase associated kinesin
  • KIAA0639kinesin-like protein KIF13B
  • kinesin family member 13B
  • Kinesin-like protein GAKIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-17046
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP1-88097
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
26520002
Species: Hu
Applications: WB, ELISA
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88911
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02597
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIF13B Antibody (NBP1-83398) (0)

There are no publications for KIF13B Antibody (NBP1-83398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF13B Antibody (NBP1-83398) (0)

There are no reviews for KIF13B Antibody (NBP1-83398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF13B Antibody (NBP1-83398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF13B Products

Bioinformatics Tool for KIF13B Antibody (NBP1-83398)

Discover related pathways, diseases and genes to KIF13B Antibody (NBP1-83398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF13B Antibody (NBP1-83398)

Discover more about diseases related to KIF13B Antibody (NBP1-83398).
 

Pathways for KIF13B Antibody (NBP1-83398)

View related products by pathway.

PTMs for KIF13B Antibody (NBP1-83398)

Learn more about PTMs related to KIF13B Antibody (NBP1-83398).

Blogs on KIF13B

There are no specific blogs for KIF13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF13B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF13B