KIF13B Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining in human parathyroid gland and skeletal muscle tissues using anti-KIF13B antibody. Corresponding KIF13B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human kidney, lymph node, parathyroid gland and skeletal muscle using Anti-KIF13B antibody NBP1-83398 (A) shows similar protein distribution across tissues to independent antibody NBP2-62619 (B).

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human skeletal muscle using Anti-KIF13B antibody NBP1-83398.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human lymph node.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human kidney.

Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human parathyroid gland using Anti-KIF13B antibody NBP1-83398.

Analysis in human kidney tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF13B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF13B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF13B Protein (NBP1-83398PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KIF13B Antibody - BSA Free

• GAKIN
• GAKINkinesin 13B
• guanylate kinase associated kinesin
• KIAA0639kinesin-like protein KIF13B
• kinesin family member 13B
• Kinesin-like protein GAKIN

Background

KIF13B is a gene that codes for a protein whose functions include facilitating in reorginzation of the cortical cytoskeleton and advocating the formation of extra axons if needed in the regulation of their formation that has a length of 1826 amino acids and a mass of approximately 203 kDa. Studies have been conducted on diseases and disorders relating to this gene, including paraplegia, spasticity, malaria and neuronitis. KIF13B has also been shown to have interactions with DLG1, BCL6, DLG$, MARK2, and TERF2 in pathways such as the Arf6 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF13B Antibody (NBP1-83398)(1)

Publication using NBP1-83398

• Fukuda M Rab10 regulates tubular endosome formation through KIF13A/B motors. J Cell Sci. 2019-02-19 [PMID: 30700496] (WB, Human)

Bioinformatics

• Gene Symbol: KIF13B