TRAIL/TNFSF10 Recombinant Protein Antigen

Images

 
There are currently no images for TRAIL/TNFSF10 Protein (NBP2-38744PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAIL/TNFSF10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNFSF10.

Source: E. coli

Amino Acid Sequence: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFSF10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38744.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAIL/TNFSF10 Recombinant Protein Antigen

  • Apo-2 ligand
  • APO2L
  • Apo-2Ltumor necrosis factor (ligand) family, member 10
  • APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta
  • CD253 antigen
  • CD253
  • Protein TRAIL
  • TL2
  • TNF-related apoptosis-inducing ligand
  • TNFSF10
  • TRAIL
  • TRAILTNF-related apoptosis inducing ligand TRAIL
  • tumor necrosis factor (ligand) superfamily, member 10
  • tumor necrosis factor ligand superfamily member 10

Background

Apoptosis or programmed cell death is induced in cells by a group of death domain containing receptors. Binding of ligand to these receptors sends signals that activate members of the caspase family of proteases. The signals ultimately cause degradation of chromosomal DNA by activating DNase. TRAIL (TNF related apoptosis induced ligand) or Apo 2L initiates apoptosis of tumor cells by binding to either of its receptors, DR4 or DR5. These receptors consist of an extracellular TRAIL binding domain and a cytoplasmic "death domain". In addition, two decoy receptors for TRAIL have also been identified. These receptors, designated DcR1 and DcR2, lack the death domain. Binding of TRAIL to either of these receptors, therefore, does not transmit the death signal. Thus, these receptors represent a novel way of regulating cell sensitivity to a pro-apoptotic cytokine at the cell surface. TRAIL is expressed predominantly in spleen, lung, and prostate but also in many other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
7398-FS
Species: Hu
Applications: BA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
DFL00B
Species: Hu
Applications: ELISA
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
DY805
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-38744PEP
Species: Hu
Applications: AC

Publications for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)

There are no publications for TRAIL/TNFSF10 Protein (NBP2-38744PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)

There are no reviews for TRAIL/TNFSF10 Protein (NBP2-38744PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAIL/TNFSF10 Products

Research Areas for TRAIL/TNFSF10 Protein (NBP2-38744PEP)

Find related products by research area.

Blogs on TRAIL/TNFSF10

There are no specific blogs for TRAIL/TNFSF10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAIL/TNFSF10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF10