TRAIL/TNFSF10 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TRAIL/TNFSF10 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNFSF10.
  
  

  Source: E. coli

  Amino Acid Sequence: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TNFSF10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38744.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAIL/TNFSF10 Recombinant Protein Antigen

• Apo-2 ligand
• APO2L
• Apo-2Ltumor necrosis factor (ligand) family, member 10
• APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta
• CD253 antigen
• CD253
• Protein TRAIL
• TL2
• TNF-related apoptosis-inducing ligand
• TNFSF10
• TRAIL
• TRAILTNF-related apoptosis inducing ligand TRAIL
• tumor necrosis factor (ligand) superfamily, member 10
• tumor necrosis factor ligand superfamily member 10

Background

Apoptosis or programmed cell death is induced in cells by a group of death domain containing receptors. Binding of ligand to these receptors sends signals that activate members of the caspase family of proteases. The signals ultimately cause degradation of chromosomal DNA by activating DNase. TRAIL (TNF related apoptosis induced ligand) or Apo 2L initiates apoptosis of tumor cells by binding to either of its receptors, DR4 or DR5. These receptors consist of an extracellular TRAIL binding domain and a cytoplasmic "death domain". In addition, two decoy receptors for TRAIL have also been identified. These receptors, designated DcR1 and DcR2, lack the death domain. Binding of TRAIL to either of these receptors, therefore, does not transmit the death signal. Thus, these receptors represent a novel way of regulating cell sensitivity to a pro-apoptotic cytokine at the cell surface. TRAIL is expressed predominantly in spleen, lung, and prostate but also in many other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TNFSF10