TRAIL/TNFSF10 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNFSF10. Source: E. coli
Amino Acid Sequence: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TNFSF10 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38744. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRAIL/TNFSF10 Recombinant Protein Antigen
Background
Apoptosis or programmed cell death is induced in cells by a group of death domain containing receptors. Binding of ligand to these receptors sends signals that activate members of the caspase family of proteases. The signals ultimately cause degradation of chromosomal DNA by activating DNase. TRAIL (TNF related apoptosis induced ligand) or Apo 2L initiates apoptosis of tumor cells by binding to either of its receptors, DR4 or DR5. These receptors consist of an extracellular TRAIL binding domain and a cytoplasmic "death domain". In addition, two decoy receptors for TRAIL have also been identified. These receptors, designated DcR1 and DcR2, lack the death domain. Binding of TRAIL to either of these receptors, therefore, does not transmit the death signal. Thus, these receptors represent a novel way of regulating cell sensitivity to a pro-apoptotic cytokine at the cell surface. TRAIL is expressed predominantly in spleen, lung, and prostate but also in many other tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: AC
Publications for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)
There are no publications for TRAIL/TNFSF10 Protein (NBP2-38744PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)
There are no reviews for TRAIL/TNFSF10 Protein (NBP2-38744PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRAIL/TNFSF10 Protein (NBP2-38744PEP) (0)
Additional TRAIL/TNFSF10 Products
Research Areas for TRAIL/TNFSF10 Protein (NBP2-38744PEP)
Find related products by research area.
|
Blogs on TRAIL/TNFSF10