TRAFD1 Antibody

Images

 
Western Blot: TRAFD1 Antibody [NBP1-81875] - Analysis in control (vector only transfected HEK293T lysate) and TRAFD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: TRAFD1 Antibody [NBP1-81875] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRAFD1 Antibody [NBP1-81875] - Staining in human testis and skeletal muscle tissues using anti-TRAFD1 antibody. Corresponding TRAFD1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: TRAFD1 Antibody [NBP1-81875] - Staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.
Immunohistochemistry-Paraffin: TRAFD1 Antibody [NBP1-81875] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: TRAFD1 Antibody [NBP1-81875] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TRAFD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSSPCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAFD1 Protein (NBP1-81875PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAFD1 Antibody

  • FLN29FLN29 gene product
  • Protein FLN29
  • TRAF-type zinc finger domain containing 1
  • TRAF-type zinc finger domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-46200
Species: Hu, Mu
Applications: IP, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
AF3076
Species: Hu
Applications: IHC, WB
NB100-1207
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
42400-1
Species: Mu
Applications: ELISA
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81875
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRAFD1 Antibody (NBP1-81875) (0)

There are no publications for TRAFD1 Antibody (NBP1-81875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAFD1 Antibody (NBP1-81875) (0)

There are no reviews for TRAFD1 Antibody (NBP1-81875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAFD1 Antibody (NBP1-81875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRAFD1 Products

Bioinformatics Tool for TRAFD1 Antibody (NBP1-81875)

Discover related pathways, diseases and genes to TRAFD1 Antibody (NBP1-81875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAFD1 Antibody (NBP1-81875)

Discover more about diseases related to TRAFD1 Antibody (NBP1-81875).
 

Pathways for TRAFD1 Antibody (NBP1-81875)

View related products by pathway.

Blogs on TRAFD1

There are no specific blogs for TRAFD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAFD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAFD1