TRAF-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRAF-3 Antibody [NBP1-86639] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAF-3 Antibody [NBP1-86639] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAF-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAF-3 Protein (NBP1-86639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAF-3 Antibody

  • CAP1
  • CAP-1CD40 receptor associated factor 1
  • CD40 associated protein 1
  • CD40 binding protein
  • CD40 receptor-associated factor 1
  • CD40-binding protein
  • CD40bp
  • CRAF1
  • CRAF1CAP1
  • LAP1
  • LAP1CD40BP
  • LMP1-associated protein 1
  • TNF receptor-associated factor 3
  • TRAF3
  • TRAF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56178
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF6027
Species: Hu
Applications: WB
AF6386
Species: Hu
Applications: WB, IP
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1162
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-86639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TRAF-3 Antibody (NBP1-86639) (0)

There are no publications for TRAF-3 Antibody (NBP1-86639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-3 Antibody (NBP1-86639) (0)

There are no reviews for TRAF-3 Antibody (NBP1-86639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRAF-3 Antibody (NBP1-86639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAF-3 Products

Bioinformatics Tool for TRAF-3 Antibody (NBP1-86639)

Discover related pathways, diseases and genes to TRAF-3 Antibody (NBP1-86639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF-3 Antibody (NBP1-86639)

Discover more about diseases related to TRAF-3 Antibody (NBP1-86639).
 

Pathways for TRAF-3 Antibody (NBP1-86639)

View related products by pathway.

PTMs for TRAF-3 Antibody (NBP1-86639)

Learn more about PTMs related to TRAF-3 Antibody (NBP1-86639).

Blogs on TRAF-3

There are no specific blogs for TRAF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAF-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3
Entrez