TRA2A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRA2A Antibody [NBP2-13473] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: TRA2A Antibody [NBP2-13473] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRA2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRA2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRA2A Protein (NBP2-13473PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRA2A Antibody

  • HSU53209
  • htra-2 alpha
  • htra-2-alpha
  • putative MAPK activating protein PM24
  • TRA-2 alpha
  • tra2a
  • Tra2alpha
  • TRA2-alpha
  • transformer 2 alpha homolog (Drosophila)
  • transformer-2 alpha
  • Transformer-2 protein homolog A
  • transformer-2 protein homolog alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB400-129
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
AF5540
Species: Mu
Applications: WB
NB100-385
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4937
Species: Hu
Applications: WB, IHC
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14942
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRA2A Antibody (NBP2-13473) (0)

There are no publications for TRA2A Antibody (NBP2-13473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRA2A Antibody (NBP2-13473) (0)

There are no reviews for TRA2A Antibody (NBP2-13473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRA2A Antibody (NBP2-13473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRA2A Products

Bioinformatics Tool for TRA2A Antibody (NBP2-13473)

Discover related pathways, diseases and genes to TRA2A Antibody (NBP2-13473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TRA2A Antibody (NBP2-13473)

View related products by pathway.

Research Areas for TRA2A Antibody (NBP2-13473)

Find related products by research area.

Blogs on TRA2A

There are no specific blogs for TRA2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRA2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRA2A