TPX2 Antibody

Images

 
Western Blot: TPX2 Antibody [NBP1-88312] - Analysis in control (vector only transfected HEK293T lysate) and tPX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TPX2 Antibody [NBP1-88312] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitotic spindle.
Immunohistochemistry-Paraffin: TPX2 Antibody [NBP1-88312] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPX2 Protein (NBP1-88312PEP)
Publications
Read Publication using NBP1-88312.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPX2 Antibody

  • C20orf1HCTP4
  • C20orf2
  • chromosome 20 open reading frame 1
  • Differentially expressed in cancerous and non-cancerous lung cells 2
  • differentially expressed in lung cells
  • DIL2
  • DIL-2FLS353
  • HCA519
  • Hepatocellular carcinoma-associated antigen 519
  • P100
  • p100GD:C20orf1
  • preferentially expressed in colorectal cancer
  • Protein fls353
  • REPP86
  • restricted expression proliferation associated protein 100
  • Restricted expression proliferation-associated protein 100
  • targeting protein for Xklp2
  • TPX2, microtubule-associated protein homolog
  • TPX2, microtubule-associated, homolog (Xenopus laevis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB2698
Species: Hu
Applications: WB, IHC, ICC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88312
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TPX2 Antibody (NBP1-88312)(1)

Reviews for TPX2 Antibody (NBP1-88312) (0)

There are no reviews for TPX2 Antibody (NBP1-88312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TPX2 Antibody (NBP1-88312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPX2 Products

Bioinformatics Tool for TPX2 Antibody (NBP1-88312)

Discover related pathways, diseases and genes to TPX2 Antibody (NBP1-88312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPX2 Antibody (NBP1-88312)

Discover more about diseases related to TPX2 Antibody (NBP1-88312).
 

Pathways for TPX2 Antibody (NBP1-88312)

View related products by pathway.

PTMs for TPX2 Antibody (NBP1-88312)

Learn more about PTMs related to TPX2 Antibody (NBP1-88312).
 

Research Areas for TPX2 Antibody (NBP1-88312)

Find related products by research area.

Blogs on TPX2

There are no specific blogs for TPX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPX2