TPR Antibody - BSA Free

Immunohistochemistry-Paraffin: TPR Antibody [NBP1-89452] - Staining of human prostate shows strong positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: TPR Antibody [NBP1-89452] - Staining of human testis shows strong positivity in nuclear membrane in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TPR Antibody [NBP1-89452] - Staining of human kidney shows strong positivity in nuclear membrane in cells in tubules.

Immunohistochemistry-Paraffin: TPR Antibody [NBP1-89452] - Staining of human cerebellum shows strong positivity in nuclear membrane in Purkinje cells.

Staining of human cell line A-431 shows localization to nuclear membrane.

Staining of human cell line A-431 shows localization to nuclear membrane.

Staining of human cerebellum, kidney, prostate and testis using Anti-TPR antibody NBP1-89452 (A) shows similar protein distribution across tissues to independent antibody NBP1-89451 (B).

Analysis in human cell line SiHa.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TPR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TPR Protein (NBP1-89452PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TPR Antibody - BSA Free

• nuclear pore complex-associated protein TPR
• nucleoprotein TPR
• translocated promoter region (to activated MET oncogene)
• tumor potentiating region

Background

TPR encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPR