TP53TG1 Antibody - Azide and BSA Free

Western Blot: TP53TG1 Antibody [H00011257-B01P] - Analysis of TP53TG1 expression in transfected 293T cell line by TP53TG1 polyclonal antibody. Lane 1: TP53AP1 transfected lysate(9.9 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TP53TG1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TP53TG1 Antibody - Azide and BSA Free (H00011257-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TP53TG1 (AAH02709.1, 1 a.a. - 90 a.a.) full-length human protein. MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ
• Specificity: TP53AP1 - TP53 activated protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TP53TG1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TP53TG1 Antibody - Azide and BSA Free

• LINC00096
• NCRNA00096
• P53TG1
• P53TG1-D
• TP53 target 1 (non-protein coding)
• TP53AP1

Background

TP53TG1 is a gene that codes for a tumor p53-activated protein that has four isoforms, with lengths of 90, 36, 60, and 31 amino acids and weights of approximately 10, 4, 7, and 3 kDa respectively. Current studies are being done on diseases and disorders related to this protein including colon cancer. TP54TG1 has also been shown to have interactions with SAT1, PTPLAD1, and TP53.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TP53TG1
• Entrez:
  • 11257(Human)