BCAS1 Antibody

Images

 
Western Blot: BCAS1 Antibody [NBP2-38736] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: BCAS1 Antibody [NBP2-38736] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining in human stomach and endometrium tissues using anti-BCAS1 antibody. Corresponding BCAS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCAS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ
Specificity
Specificity of human BCAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BCAS1 Protein (NBP2-38736PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCAS1 Antibody

  • breast carcinoma amplified sequence 1
  • breast carcinoma-amplified sequence 1
  • NABC1AIBC1Amplified and overexpressed in breast cancer
  • Novel amplified in breast cancer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-314
Species: Hu
Applications: WB, IP
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003249-P01
Species: Hu
Applications: WB
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4505
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
H00009498-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-57770
Species: Hu
Applications: WB
NBP1-46156
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready

Publications for BCAS1 Antibody (NBP2-38736) (0)

There are no publications for BCAS1 Antibody (NBP2-38736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAS1 Antibody (NBP2-38736) (0)

There are no reviews for BCAS1 Antibody (NBP2-38736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BCAS1 Antibody (NBP2-38736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BCAS1 Antibody (NBP2-38736)

Discover related pathways, diseases and genes to BCAS1 Antibody (NBP2-38736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAS1 Antibody (NBP2-38736)

Discover more about diseases related to BCAS1 Antibody (NBP2-38736).
 

Pathways for BCAS1 Antibody (NBP2-38736)

View related products by pathway.

Research Areas for BCAS1 Antibody (NBP2-38736)

Find related products by research area.

Blogs on BCAS1

There are no specific blogs for BCAS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCAS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAS1
Uniprot