Torsin 2A Antibody - BSA Free

Immunohistochemistry-Paraffin: Torsin 2A Antibody [NBP2-68915] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Torsin 2A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOR2A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Torsin 2A Recombinant Protein Antigen (NBP2-68915PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Torsin 2A Antibody - BSA Free

• FLJ14771
• MGC99558
• pro salusin
• prosalusin
• TORP1torsin-2A
• Torsin family 2 member A
• torsin family 2, member A
• Torsin-2A
• Torsin-related protein 1

Background

TOR2A - torsin family 2, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOR2A