TOR1AIP2 Antibody

Images

 
Western Blot: TOR1AIP2 Antibody [NBP2-85971] - WB Suggested Anti-TOR1AIP2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Product Details

Summary
Reactivity Hu, Rt, YeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOR1AIP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. Peptide sequence: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Yeast (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TOR1AIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOR1AIP2 Antibody

  • FLJ77012
  • IFRG15
  • interferon responsive gene 15
  • LULL1MGC120077
  • lumenal domain like LAP1
  • Lumenal domain-like LAP1
  • MGC120074
  • MGC120075
  • MGC120076
  • MGC126581
  • MGC138430
  • NET9
  • RP11-12M5.5
  • torsin A interacting protein 2
  • torsin-1A-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-49175
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-47403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-27199
Species: Hu, Eq, Pm
Applications: IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-85971
Species: Hu, Rt, Ye
Applications: WB

Publications for TOR1AIP2 Antibody (NBP2-85971) (0)

There are no publications for TOR1AIP2 Antibody (NBP2-85971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR1AIP2 Antibody (NBP2-85971) (0)

There are no reviews for TOR1AIP2 Antibody (NBP2-85971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOR1AIP2 Antibody (NBP2-85971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOR1AIP2 Products

Bioinformatics Tool for TOR1AIP2 Antibody (NBP2-85971)

Discover related pathways, diseases and genes to TOR1AIP2 Antibody (NBP2-85971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR1AIP2 Antibody (NBP2-85971)

Discover more about diseases related to TOR1AIP2 Antibody (NBP2-85971).
 

Pathways for TOR1AIP2 Antibody (NBP2-85971)

View related products by pathway.

Blogs on TOR1AIP2

There are no specific blogs for TOR1AIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOR1AIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOR1AIP2