SUN1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87396 (A) shows similar protein ...read more
Western Blot: SUN1 Antibody [NBP1-87396] - Western blot analysis of protein expression levels in control and irradiated MCF7 and U2OS cells. Blot cuts showing signals of intact proteins. Note, reduction of SUN2 protein ...read more
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of SUN1 a& nesprin-1 mislocalization in MCF7 and U2OS cells 24 h PI with 8 Gy of gamma-rays. 1a-Central slices through nucleus of MCF7 ...read more
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI ...read more
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.
Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of nuclear morphology defects in (A) MCF7 & (B) U2OS cell lines 24 h PI with the dose of 8 Gy of gamma -rays. (A) 1—An anaphase bridge ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SUN1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit SUN1 Antibody - BSA Free (NBP1-87396) is a polyclonal antibody validated for use in IHC, WB, ICC/IF, Simple Western and IP. Anti-SUN1 Antibody: Cited in 15 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunoprecipitation Reported in scientific literature (PMID: 25210889).
  • Simple Western 1:20
  • Western Blot Reactivity reported in scientific literature (PMID: 25210889).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 113 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SUN1 Protein (NBP1-87396PEP)
Publications
Read Publications using
NBP1-87396 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SUN1 Antibody - BSA Free

  • KIAA0810UNC84AFLJ12407
  • MGC176649
  • Protein unc-84 homolog A
  • Sad1 and UNC84 domain containing 1
  • Sad1 unc-84 domain protein 1
  • Sad1/unc-84 protein-like 1
  • SUN domain-containing protein 1
  • unc-84 homolog A (C. elegans)
  • unc-84 homolog A

Background

This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62573
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-42886
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DY4517-05
Species: Mu
Applications: ELISA
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-93890
Species: Hu, Mu
Applications: ICC/IF, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3076
Species: Hu
Applications: IHC, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80665
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2388
Species: Hu
Applications: WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IP

Publications for SUN1 Antibody (NBP1-87396)(16)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 6 applications: ICC/IF, IP, Immunocytochemistry, Immunocytochemistry/ Immunofluorescence, WB, Western Blot.


Filter By Application
ICC/IF
(5)
IP
(1)
Immunocytochemistry
(1)
Immunocytochemistry/ Immunofluorescence
(1)
WB
(5)
Western Blot
(1)
All Applications
Filter By Species
Human
(4)
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using NBP1-87396 Applications Species
Rosencrance C, Walsh D Microtubule mechanotransduction refines cytomegalovirus interactions with and remodeling of host chromatin Nature Communications 2025-08-13 [PMID: 40804345]
Amanda L. Gunn, Artem I. Yashchenko, Julien Dubrulle, Jodiene Johnson, Emily M. Hatch A high-content screen reveals new regulators of nuclear membrane stability Scientific Reports 2024-03-12 [PMID: 38472343]
Gunn AL, Yashchenko AI, Dubrulle J et al. A high-content screen reveals new regulators of nuclear membrane stability bioRxiv : the preprint server for biology 2023-09-10 [PMID: 37398267] (WB, Human)

Details:
1:1000 WB dilution
WB Human
Park JW, Lee EJ, Moon E et Al. Orthodenticle homeobox 2 is transported to lysosomes by nuclear budding vesicles Nat Commun 2023-02-27 [PMID: 36849521] (Western Blot, Immunocytochemistry, Immunocytochemistry/ Immunofluorescence) Western Blot, Immunocytochemistry, Immunocytochemistry/ Immunofluorescence
Kong Y, Zhang Y, Wang H Et al. Inner nuclear membrane protein TMEM201 promotes breast cancer metastasis by positive regulating TGFbeta signaling Oncogene 2021-11-19 [PMID: 34799661] (WB) WB
Procter DJ, Furey C, Garza-Gongora AG et al. Cytoplasmic control of intranuclear polarity by human cytomegalovirus Nature 2020-09-09 [PMID: 32908309] (WB) WB
Alena S K, Bartova E et al. Spatiotemporal Mislocalization of Nuclear Membrane-Associated Proteins in gamma-Irradiation-Induced Senescent Cells. Cells 2020-04-17 [PMID: 32316379] (ICC/IF, WB, Human) ICC/IF, WB Human
Takaki T, Montagner M, Serres MP et al. Actomyosin drives cancer cell nuclear dysmorphia and threatens genome stability Nat Commun 2017-07-24 [PMID: 28737169] (ICC/IF, Human) ICC/IF Human
Rog O, Kohler S, Dernburg AF. The synaptonemal complex has liquid crystalline properties and spatially regulates meiotic recombination factors Elife 2017-01-03 [PMID: 28045371] (ICC/IF) ICC/IF
Meinke P, Mattioli E, Haque F et al. Muscular Dystrophy-Associated SUN1 and SUN2 Variants Disrupt Nuclear-Cytoskeletal Connections and Myonuclear Organization. PLoS Genet 2014-09-01 [PMID: 25210889] (ICC/IF, WB, IP, Human) ICC/IF, WB, IP Human
Show All 16 Publications.

Reviews for SUN1 Antibody (NBP1-87396) (0)

There are no reviews for SUN1 Antibody (NBP1-87396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUN1 Antibody (NBP1-87396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUN1 Products

Array NBP1-87396

Research Areas for SUN1 Antibody (NBP1-87396)

Find related products by research area.

Blogs on SUN1

There are no specific blogs for SUN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUN1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SUN1
Entrez
Uniprot