SUN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human placenta shows strong nuclear membrane positivity in trophoblastic cells.
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI ...read more
Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Western Blot reactivity reported in scientific literature (PMID: 25210889).
Control Peptide
SUN1 Protein (NBP1-87396PEP)
Publications
Read Publications using
NBP1-87396 in the following applications:

  • 4 publications
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21610090)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUN1 Antibody

  • KIAA0810UNC84AFLJ12407
  • MGC176649
  • Protein unc-84 homolog A
  • Sad1 and UNC84 domain containing 1
  • Sad1 unc-84 domain protein 1
  • Sad1/unc-84 protein-like 1
  • SUN domain-containing protein 1
  • unc-84 homolog A (C. elegans)
  • unc-84 homolog A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-49175
Species: Hu
Applications: WB, IHC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
AF3155
Species: Mu
Applications: WB, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUN1 Antibody (NBP1-87396)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(4)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using NBP1-87396 Applications Species
Takaki T, Montagner M, Serres MP et al. Actomyosin drives cancer cell nuclear dysmorphia and threatens genome stability Nat Commun 2017 Jul 24 [PMID: 28737169] (ICC/IF, Human) ICC/IF Human
Rog O, Kohler S, Dernburg AF. The synaptonemal complex has liquid crystalline properties and spatially regulates meiotic recombination factors Elife Jan 3 2017 [PMID: 28045371] (ICC/IF) ICC/IF
Meinke P, Mattioli E, Haque F et al. Muscular Dystrophy-Associated SUN1 and SUN2 Variants Disrupt Nuclear-Cytoskeletal Connections and Myonuclear Organization. PLoS Genet 2014 Sep [PMID: 25210889] (IP, WB, ICC/IF, Human) IP, WB, ICC/IF Human
Horn HF, Kim DI, Wright GD et al. A mammalian KASH domain protein coupling meiotic chromosomes to the cytoskeleton. J Cell Biol 2013 Sep 30 [PMID: 24062341]
Crabbe L, Cesare AJ, Kasuboski JM et al. Human telomeres are tethered to the nuclear envelope during post-mitotic nuclear assembly. Cell Rep 2012 Dec 27 [PMID: 23260663]
Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012 Apr [PMID: 22361696]
Gudise S, Figueroa RA, Lindberg R et al. Samp1 is functionally associated with the LINC complex and A-type lamina networks. J Cell Sci 2011 Jun 15 [PMID: 21610090] (ICC/IF) ICC/IF
Zwerger M, Kolb T, Richter K et al. Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7. Mol Biol Cell. 2010 Jan. [PMID: 19940018]
Ramachandran R, Pucadyil TJ, Liu YW et al. Membrane insertion of the pleckstrin homology domain variable loop 1 is critical for dynamin-catalyzed vesicle scission. Mol Biol Cell. 2009 Nov. [PMID: 19776347]

Reviews for SUN1 Antibody (NBP1-87396) (0)

There are no reviews for SUN1 Antibody (NBP1-87396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUN1 Antibody (NBP1-87396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUN1 Products

Bioinformatics Tool for SUN1 Antibody (NBP1-87396)

Discover related pathways, diseases and genes to SUN1 Antibody (NBP1-87396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUN1 Antibody (NBP1-87396)

Discover more about diseases related to SUN1 Antibody (NBP1-87396).
 

Pathways for SUN1 Antibody (NBP1-87396)

View related products by pathway.

PTMs for SUN1 Antibody (NBP1-87396)

Learn more about PTMs related to SUN1 Antibody (NBP1-87396).

Blogs on SUN1

There are no specific blogs for SUN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUN1
Entrez
Uniprot