Orthogonal Strategies: Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87396 (A) shows similar protein ...read more
Western Blot: SUN1 Antibody [NBP1-87396] - Western blot analysis of protein expression levels in control and irradiated MCF7 and U2OS cells. Blot cuts showing signals of intact proteins. Note, reduction of SUN2 protein ...read more
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of SUN1 a& nesprin-1 mislocalization in MCF7 and U2OS cells 24 h PI with 8 Gy of gamma-rays. 1a-Central slices through nucleus of MCF7 ...read more
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI ...read more
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.
Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of nuclear morphology defects in (A) MCF7 & (B) U2OS cell lines 24 h PI with the dose of 8 Gy of gamma -rays. (A) 1—An anaphase bridge ...read more
Novus Biologicals Rabbit SUN1 Antibody - BSA Free (NBP1-87396) is a polyclonal antibody validated for use in IHC, WB, ICC/IF, Simple Western and IP. Anti-SUN1 Antibody: Cited in 15 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunoprecipitation Reported in scientific literature (PMID: 25210889).
Simple Western 1:20
Western Blot Reactivity reported in scientific literature (PMID: 25210889).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 113 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SUN1 Antibody - BSA Free
KIAA0810UNC84AFLJ12407
MGC176649
Protein unc-84 homolog A
Sad1 and UNC84 domain containing 1
Sad1 unc-84 domain protein 1
Sad1/unc-84 protein-like 1
SUN domain-containing protein 1
unc-84 homolog A (C. elegans)
unc-84 homolog A
Background
This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SUN1 Antibody - BSA Free and receive a gift card or discount.