TOM1L2 Antibody - BSA Free

Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.

Staining of human cerebral cortex, heart muscle, liver and testis using Anti-TOM1L2 antibody NBP1-86006 (A) shows similar protein distribution across tissues to independent antibody NBP1-86414 (B).

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOM1L2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEML
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOM1L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TOM1L2 Protein (NBP1-86006PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOM1L2 Antibody - BSA Free

• FLJ21501
• FLJ32746
• target of myb1 (chicken) homolog-like 1
• target of myb1-like 2 (chicken)
• Target of Myb-like protein 2
• TOM1-like protein 2

Background

Tom1L2 (Tom1-like2) together with Tom1L1 (Tom1-like1) and related proteins Tom1 (Target of Myb1) constitute a new protein family characterized by the presence of a VHS (Vps27p/Hrs/Stam) domain in the N-terminal portion followed by a GAT (GGA and Tom) domain. The molecular function of TOM1L2 is as an intra-Golgi protein transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOM1L2