TNPO3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TNPO3 Antibody [NBP1-81585] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: TNPO3 Antibody [NBP1-81585] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TNPO3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLRSQVVIPILQWAIASTTLDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNPO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
TNPO3 Protein (NBP1-81585PEP)

Alternate Names for TNPO3 Antibody

  • imp12
  • MTR10A
  • transportin 3
  • transportin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3468
Species: Hu
Applications: WB, ICC
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5745R
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
AF1138
Species: Hu
Applications: WB, Flow, IHC, Neut
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-20324
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81585
Species: Hu, Mouse, Rat
Applications: ICC/IF, IHC, IHC-P

Publications for TNPO3 Antibody (NBP1-81585) (0)

There are no publications for TNPO3 Antibody (NBP1-81585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNPO3 Antibody (NBP1-81585) (0)

There are no reviews for TNPO3 Antibody (NBP1-81585). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TNPO3 Antibody (NBP1-81585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNPO3 Antibody Products

Related Products by Gene

Bioinformatics Tool for TNPO3 Antibody (NBP1-81585)

Discover related pathways, diseases and genes to TNPO3 Antibody (NBP1-81585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNPO3 Antibody (NBP1-81585)

Discover more about diseases related to TNPO3 Antibody (NBP1-81585).
 

Pathways for TNPO3 Antibody (NBP1-81585)

View related products by pathway.

PTMs for TNPO3 Antibody (NBP1-81585)

Learn more about PTMs related to TNPO3 Antibody (NBP1-81585).

Blogs on TNPO3

There are no specific blogs for TNPO3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TNPO3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81585 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought