TNPO3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TNPO3 Antibody [NBP1-81585] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: TNPO3 Antibody [NBP1-81585] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TNPO3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLRSQVVIPILQWAIASTTLDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNPO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
TNPO3 Protein (NBP1-81585PEP)

Alternate Names for TNPO3 Antibody

  • imp12
  • MTR10A
  • transportin 3
  • transportin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3468
Species: Hu
Applications: WB, ICC
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5745R
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB726
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF5789
Species: Hu, Mu, Rt
Applications: WB
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-20324
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TNPO3 Antibody (NBP1-81585) (0)

There are no publications for TNPO3 Antibody (NBP1-81585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNPO3 Antibody (NBP1-81585) (0)

There are no reviews for TNPO3 Antibody (NBP1-81585). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TNPO3 Antibody (NBP1-81585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNPO3 Antibody Products

Related Products by Gene

Bioinformatics Tool for TNPO3 Antibody (NBP1-81585)

Discover related pathways, diseases and genes to TNPO3 Antibody (NBP1-81585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNPO3 Antibody (NBP1-81585)

Discover more about diseases related to TNPO3 Antibody (NBP1-81585).
 

Pathways for TNPO3 Antibody (NBP1-81585)

View related products by pathway.

PTMs for TNPO3 Antibody (NBP1-81585)

Learn more about PTMs related to TNPO3 Antibody (NBP1-81585).

Blogs on TNPO3

There are no specific blogs for TNPO3, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our TNPO3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNPO3

Customers Who Bought This Also Bought