TNFAIP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TNFAIP2 Antibody [NBP2-55173] - Staining of human cell line RT4 shows localization to nucleoplasm, nuclear membrane, cytosol & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNFAIP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSH
Specificity
Specificity of human TNFAIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFAIP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TNFAIP2 Recombinant Protein Antigen (NBP2-55173PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TNFAIP2 Antibody

  • B94
  • EXOC3L3
  • exocyst complex component 3-like 3
  • Primary response gene B94 protein
  • TNF alpha-induced protein 2
  • tumor necrosis factor alpha-induced protein 2
  • tumor necrosis factor, alpha-induced protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
7954-GM/CF
Species: Hu
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF2656
Species: Hu
Applications: WB, IHC
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS

Publications for TNFAIP2 Antibody (NBP2-55173) (0)

There are no publications for TNFAIP2 Antibody (NBP2-55173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNFAIP2 Antibody (NBP2-55173) (0)

There are no reviews for TNFAIP2 Antibody (NBP2-55173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TNFAIP2 Antibody (NBP2-55173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TNFAIP2 Products

Bioinformatics Tool for TNFAIP2 Antibody (NBP2-55173)

Discover related pathways, diseases and genes to TNFAIP2 Antibody (NBP2-55173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP2 Antibody (NBP2-55173)

Discover more about diseases related to TNFAIP2 Antibody (NBP2-55173).
 

Pathways for TNFAIP2 Antibody (NBP2-55173)

View related products by pathway.

PTMs for TNFAIP2 Antibody (NBP2-55173)

Learn more about PTMs related to TNFAIP2 Antibody (NBP2-55173).
 

Research Areas for TNFAIP2 Antibody (NBP2-55173)

Find related products by research area.

Blogs on TNFAIP2

There are no specific blogs for TNFAIP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNFAIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP2