TMEM97 Antibody - BSA Free

Western Blot: TMEM97 Antibody [NBP3-16973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunocytochemistry/Immunofluorescence: TMEM97 Antibody [NBP3-16973] - Staining of human cell line CACO-2 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: TMEM97 Antibody [NBP3-16973] - Staining of human salivary gland shows low expression as expected.

Immunohistochemistry-Paraffin: TMEM97 Antibody [NBP3-16973] - Analysis in human pancreas and salivary gland tissues using Anti-TMEM97 antibody. Corresponding TMEM97 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TMEM97 Antibody [NBP3-16973] - Staining of human pancreas shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM97 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM97 Antibody - BSA Free (NBP3-16973) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM97
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM97 Antibody - BSA Free

• MAC30
• MAC30Protein MAC30
• S2R
• Sigma2 receptor
• Sigma-2 receptor
• TMEM97
• transmembrane protein 97

Background

TMEM97, or MAC30, is a conserved transmembrane protein that helps regulate cellular cholesterol levels through colocalization with NPC1. TMEM97 has also been linked to several cancers including breast, pancreatic, colorectal and ovarian cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM97