TMEM38A Antibody - BSA Free

Western Blot: TMEM38A Antibody [NBP2-13452] - Analysis in control (vector only transfected HEK293T lysate) and TMEM38A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining in human skeletal muscle and prostate tissues using anti-TMEM38A antibody. Corresponding TMEM38A RNA-seq data are presented for the same tissues.

Western Blot: TMEM38A Antibody [NBP2-13452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)

Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human skeletal muscle shows high expression.

Staining of human prostate shows low expression as expected.

Analysis in human skeletal muscle and prostate tissues using Anti-TMEM38A antibody. Corresponding TMEM38A RNA-seq data are presented for the same tissues.

Analysis in control (vector only transfected HEK293T lysate) and TMEM38A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM38A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM38A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMEM38A Protein (NBP2-13452PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM38A Antibody - BSA Free

• transmembrane protein 38ATRIC-AMGC3169
• TRICA
• trimeric intracellular cation channel type A

Background

Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as apotassium counter-ion channel that functions in synchronization with calcium release from intracellular stores (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM38A