TMEM38A Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human skeletal muscle shows nuclear membranous and cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Frozen: TMEM38A Antibody [NBP2-13452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM38A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMP AKSKEELSEGSRKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM38A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM38A Protein (NBP2-13452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM38A Antibody

  • transmembrane protein 38ATRIC-AMGC3169
  • TRICA
  • trimeric intracellular cation channel type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-77093
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34184
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-82840
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85184
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13452
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for TMEM38A Antibody (NBP2-13452) (0)

There are no publications for TMEM38A Antibody (NBP2-13452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM38A Antibody (NBP2-13452) (0)

There are no reviews for TMEM38A Antibody (NBP2-13452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM38A Antibody (NBP2-13452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM38A Products

Bioinformatics Tool for TMEM38A Antibody (NBP2-13452)

Discover related pathways, diseases and genes to TMEM38A Antibody (NBP2-13452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM38A Antibody (NBP2-13452)

Discover more about diseases related to TMEM38A Antibody (NBP2-13452).

Blogs on TMEM38A

There are no specific blogs for TMEM38A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM38A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM38A