TMEM38A Antibody


Western Blot: TMEM38A Antibody [NBP2-13452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining in human skeletal muscle and prostate tissues using anti-TMEM38A antibody. Corresponding TMEM38A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human skeletal muscle shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P

Order Details

TMEM38A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMP AKSKEELSEGSRKK
Specificity of human TMEM38A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM38A Protein (NBP2-13452PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM38A Antibody

  • transmembrane protein 38ATRIC-AMGC3169
  • trimeric intracellular cation channel type A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for TMEM38A Antibody (NBP2-13452) (0)

There are no publications for TMEM38A Antibody (NBP2-13452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM38A Antibody (NBP2-13452) (0)

There are no reviews for TMEM38A Antibody (NBP2-13452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM38A Antibody (NBP2-13452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM38A Products

Bioinformatics Tool for TMEM38A Antibody (NBP2-13452)

Discover related pathways, diseases and genes to TMEM38A Antibody (NBP2-13452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM38A Antibody (NBP2-13452)

Discover more about diseases related to TMEM38A Antibody (NBP2-13452).

Blogs on TMEM38A

There are no specific blogs for TMEM38A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM38A Antibody and receive a gift card or discount.


Gene Symbol TMEM38A