ZSCAN16 Antibody


Western Blot: ZSCAN16 Antibody [NBP1-85184] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ZSCAN16 Antibody [NBP1-85184] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: ZSCAN16 Antibody [NBP1-85184] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZSCAN16 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGR
Specificity of human ZSCAN16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZSCAN16 Protein (NBP1-85184PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZSCAN16 Antibody

  • dJ265C24.3
  • FLJ22191
  • zinc finger and SCAN domain containing 16
  • zinc finger and SCAN domain-containing protein 16
  • Zinc finger protein 392ZNF392
  • Zinc finger protein 435ZNF435


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZSCAN16 Antibody (NBP1-85184) (0)

There are no publications for ZSCAN16 Antibody (NBP1-85184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZSCAN16 Antibody (NBP1-85184) (0)

There are no reviews for ZSCAN16 Antibody (NBP1-85184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZSCAN16 Antibody (NBP1-85184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZSCAN16 Products

Bioinformatics Tool for ZSCAN16 Antibody (NBP1-85184)

Discover related pathways, diseases and genes to ZSCAN16 Antibody (NBP1-85184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZSCAN16 Antibody (NBP1-85184)

Discover more about diseases related to ZSCAN16 Antibody (NBP1-85184).

Blogs on ZSCAN16

There are no specific blogs for ZSCAN16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZSCAN16 Antibody and receive a gift card or discount.


Gene Symbol ZSCAN16