ZSCAN16 Antibody

Western Blot: ZSCAN16 Antibody [NBP1-85184] - Analysis in control (vector only transfected HEK293T lysate) and ZSCAN16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ZSCAN16 Antibody [NBP1-85184] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.

Immunohistochemistry-Paraffin: ZSCAN16 Antibody [NBP1-85184] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZSCAN16 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZSCAN16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZSCAN16 Protein (NBP1-85184PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZSCAN16 Antibody

• dJ265C24.3
• FLJ22191
• zinc finger and SCAN domain containing 16
• zinc finger and SCAN domain-containing protein 16
• Zinc finger protein 392ZNF392
• Zinc finger protein 435ZNF435

Background

ZSCAN16 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZSCAN16