SYTL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SYTL3 Antibody [NBP1-83942] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center & vesicles.
Immunohistochemistry-Paraffin: SYTL3 Antibody [NBP1-83942] - Staining of human esophagus shows strong cytoplasmic positivity in superficial layers of squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYTL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYTL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SYTL3 Protein (NBP1-83942PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYTL3 Antibody

  • exophilin-6
  • MGC105130
  • MGC118883
  • MGC118884
  • SLP3MGC118885
  • synaptotagmin-like 3
  • synaptotagmin-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-16657
Species: Hu
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP2-45464
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
20760002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88657
Species: Hu
Applications: IHC, IHC-P
NBP2-24500
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
AF8064
Species: Hu
Applications: WB, IHC, ICC

Publications for SYTL3 Antibody (NBP1-83942) (0)

There are no publications for SYTL3 Antibody (NBP1-83942).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYTL3 Antibody (NBP1-83942) (0)

There are no reviews for SYTL3 Antibody (NBP1-83942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SYTL3 Antibody (NBP1-83942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYTL3 Products

Bioinformatics Tool for SYTL3 Antibody (NBP1-83942)

Discover related pathways, diseases and genes to SYTL3 Antibody (NBP1-83942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYTL3 Antibody (NBP1-83942)

Discover more about diseases related to SYTL3 Antibody (NBP1-83942).
 

Pathways for SYTL3 Antibody (NBP1-83942)

View related products by pathway.

Blogs on SYTL3

There are no specific blogs for SYTL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYTL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYTL3