| Reactivity | Hu, Rt, Po, FeSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TMEM119 Antibody - BSA Free (NBP2-30551) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM119 Antibody: Cited in 12 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM119 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Human | 05/20/2021 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Rat | 07/28/2020 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Sheep | 03/13/2020 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Vicki Swier |
IHC-P | Swine | 04/23/2018 |
Summary
Comments
|
||||||||||
|
reviewed by:
Verified Customer |
IHC-Fr | Feline | 01/31/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
|
Antibody treatment can generate microglia-like cells from bone marrow By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys... Read full blog post. |
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 05/20/2021 |
||
| Application: | ICC | |
| Species: | Human |
| Verified Customer 07/28/2020 |
||
| Application: | IHC-Fr | |
| Species: | Rat |
| Verified Customer 03/13/2020 |
||
| Application: | IHC-Fr | |
| Species: | Sheep |