TMEM119 Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Transmembrane Protein 119 Antibody [NBP2-30551] - Staining of human tonsil shows strong positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM119 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM119
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM119 Protein (NBP2-30551PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP2-30551 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM119 Antibody

  • OBIF
  • Osteoblast Induction Factor
  • TMEM119

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30551
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM119 Antibody (NBP2-30551) (0)

There are no publications for TMEM119 Antibody (NBP2-30551).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TMEM119 Antibody (NBP2-30551) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Feline.
We have 1 review tested in 1 application: IHC-Fr.

Reviews using NBP2-30551:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Feline
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen TMEM119 NBP2-30551
Enlarge
reviewed by:
Anonymous
IHC-Fr Feline 01/31/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample Testedoptic nerve,Nerve pia mater
SpeciesFeline
LotB106244

Comments

CommentsPFA fixed and cryoprotected tissue.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM119 Antibody (NBP2-30551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM119 Products

Bioinformatics Tool for TMEM119 Antibody (NBP2-30551)

Discover related pathways, diseases and genes to TMEM119 Antibody (NBP2-30551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM119 Antibody (NBP2-30551)

Discover more about diseases related to TMEM119 Antibody (NBP2-30551).
 

Pathways for TMEM119 Antibody (NBP2-30551)

View related products by pathway.

Blogs on TMEM119

There are no specific blogs for TMEM119, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
01/31/2017
Application: IHC-Fr
Species: Feline

Bioinformatics

Gene Symbol TMEM119
Uniprot