TMEM119 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining in human lymph node and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody NBP2-30551 (A) shows similar ...read more
Immunocytochemistry/ Immunofluorescence: TMEM119 Antibody [NBP2-30551] - Human microglia cell line stained with TMEM antibody and DAPI. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Pig cerebral cortex. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex shows weak positivity in microglia.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human testis shows weak membranous positivity in cells in lamina propria.

Product Details

Summary
Reactivity Hu, Rt, Po, FeSpecies Glossary
Applications ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM119 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM119
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID: 29109020). TMEM119 antibody is validated for IHC-F, IHC-P, ICC/IF from verified customer reviews.
Control Peptide
TMEM119 Protein (NBP2-30551PEP)
Reviewed Applications
Read 5 Reviews rated 2.6
using
NBP2-30551 in the following applications:

Publications
Read Publications using
NBP2-30551 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat reactivity reported in scientific literature (PMID: 29109020). Feline, Porcine reactivity reported from verified customer reviews.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM119 Antibody

  • OBIF
  • Osteoblast Induction Factor
  • TMEM119

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
MAB7547
Species: Hu
Applications: ICC, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56443
Species: Hu, Mu, Rt
Applications: WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-61799
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-94336
Species: Hu
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NB100-59774
Species: Hu
Applications: ChIP, IHC, IHC-P, IP, WB
DPI00
Species: Hu
Applications: ELISA
NBP2-30551
Species: Hu, Rt, Po, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TMEM119 Antibody (NBP2-30551)(5)

Reviews for TMEM119 Antibody (NBP2-30551) (5) 2.65

Average Rating: 2.6
(Based on 5 reviews)
We have 5 reviews tested in 5 species: Human, Rat, Feline, Sheep
, Swine.

Reviews using NBP2-30551:
Filter by Applications
ICC
(1)
IHC-Fr
(3)
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
Rat
(1)
Feline
(1)
Sheep
(1)
Swine
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry TMEM119 NBP2-30551
Enlarge
4
reviewed by:
Verified Customer
ICC Human 05/20/2021
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman microglia
SpeciesHuman
Lotb118061
Immunohistochemistry-Frozen TMEM119 NBP2-30551
Enlarge
1
reviewed by:
Verified Customer
IHC-Fr Rat 07/28/2020
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult brain,Coronal rat brain slices
SpeciesRat
LotB118061

Comments

CommentsRats were perfused with 4% paraformaldehyde in PBS (pH=7.6). The brain was removed and immersed in PFA then in 30% sucrose. The brain was sliced with a freezing microtome. A mixture of 1% Triton-X and 10% donkey serum (in TRIS) was used for antigen retrieval and blocking.
Tmem119 antibody was used in 1:100 dilution and was visualized by an Alexa-488 conjugated anti-rabbit secondary antibody (1:200). Cell bodies were stained with NeuroTrace 640/660 (1:250).
*Novus Biologicals Response: Thank you for reviewing our product. We are sorry to that that this antibody did not perform as expected for you. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction.
Immunohistochemistry-Frozen TMEM119 NBP2-30551
Enlarge
1
reviewed by:
Verified Customer
IHC-Fr Sheep
 03/13/2020
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedBrain (hypothalamus) tissue
SpeciesSheep
LotC119313

Comments

Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody:
To test, we used free-floating sheep hypothalamic brain sections from two animals. We did dilutions of 1:100 to 1:1000 and did not see any staining in our tissue using this antibody NBP2-30551. We also employed an antigen retrieval step in one of our runs, and it did not yield any positive staining.
Immunohistochemistry-Paraffin TMEM119 NBP2-30551
Enlarge
4
reviewed by:
Vicki Swier
IHC-P Swine 04/23/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Tested brain (thalamus),brain (aqueduct),Brain (cerebral cortex),Brain (hippocampus) tissue
SpeciesSwine
LotB114525

Comments

Comments1:100 dilution. 5 minute DAB stain. Polymer secondary. pH 6 Citrate buffer used for antigen retrieval by steam heat.
Immunohistochemistry-Frozen TMEM119 NBP2-30551
Enlarge
3
reviewed by:
Verified Customer
IHC-Fr Feline 01/31/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedNerve pia mater,optic nerve
SpeciesFeline
LotB106244

Comments

CommentsPFA fixed and cryoprotected tissue.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM119 Antibody (NBP2-30551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM119 Products

Bioinformatics Tool for TMEM119 Antibody (NBP2-30551)

Discover related pathways, diseases and genes to TMEM119 Antibody (NBP2-30551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM119 Antibody (NBP2-30551)

Discover more about diseases related to TMEM119 Antibody (NBP2-30551).
 

Pathways for TMEM119 Antibody (NBP2-30551)

View related products by pathway.

Blogs on TMEM119.

Antibody treatment can generate microglia-like cells from bone marrow
By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys...  Read full blog post.

TMEM 119 is a specific marker of microglia cells
By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.6
5
0
4
2
3
1
2
0
1
2

Verified Customer
05/20/2021
Application: ICC
Species: Human

Verified Customer
07/28/2020
Application: IHC-Fr
Species: Rat

Verified Customer
03/13/2020
Application: IHC-Fr
Species: Sheep

Bioinformatics

Gene Symbol TMEM119
Uniprot