After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Immunocytochemistry/ Immunofluorescence: Tm9sf3 Antibody [NBP1-80736] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Staining of human skeletal muscle shows no positivity in myocytes.
Staining of human stomach shows strong positivity in cytoplasm granular in glandular cells.
Staining of human prostate shows strong positivity in cytoplasm granular in glandular cells.
Staining of human colon shows strong positivity in cytoplasm granular in glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM9SF3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Tm9sf3 Antibody - BSA Free
transmembrane 9 superfamily member 3
Background
Tm9sf3 is a gene that codes for a multi-pass membrane protein that is 589 amino acids long and weighs approximately 68 kDa. Current studies are being done on diseases and disorders related to this gene including Alzheimer's disease and malaria. Tm9sf3 has also been shown to have interactions with UNC93B1, SYS1, UBC, and ELAVL1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Tm9sf3 Antibody - BSA Free and receive a gift card or discount.