Tm9sf3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Tm9sf3 Antibody [NBP1-80736] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Tm9sf3 Antibody [NBP1-80736] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tm9sf3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM9SF3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Tm9sf3 Protein (NBP1-80736PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tm9sf3 Antibody - BSA Free

• transmembrane 9 superfamily member 3

Background

Tm9sf3 is a gene that codes for a multi-pass membrane protein that is 589 amino acids long and weighs approximately 68 kDa. Current studies are being done on diseases and disorders related to this gene including Alzheimer's disease and malaria. Tm9sf3 has also been shown to have interactions with UNC93B1, SYS1, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tm9sf3 Antibody (NBP1-80736)(2)

Publications using NBP1-80736

• Milara J, MartInez-ExpOsito F, Montero P et al. N-acetylcysteine Reduces Inflammasome Activation Induced by SARS-CoV-2 Proteins In Vitro International Journal of Molecular Sciences 2022-11-22 [PMID: 36498845] (IHC-P, Human)
  
  Details:
  differentiated 937 macrophages were stimulated
• Hung CH, Hsu HY, Chiou HC et al. Arsenic Induces M2 Macrophage Polarization and Shifts M1/M2 Cytokine Production via Mitophagy International journal of molecular sciences 2022-11-10 [PMID: 36430358] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: TM9SF3
• Entrez:
  • 56889(Human)