TM2D3 Antibody - BSA Free

Western Blot: TM2D3 Antibody [NBP2-83658] - WB Suggested Anti-Tm2d3 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TM2D3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TM2D3 Antibody - BSA Free (NBP2-83658) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of TM2D3. Peptide sequence: TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM2D3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TM2D3 Antibody - BSA Free

• BBP-like protein 2
• BLP2Beta-amyloid-binding protein-like protein 2
• FLJ22604
• TM2 domain containing 3
• TM2 domain-containing protein 3

Background

TM2D3 is encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM2D3