TINAGL1 Antibody - BSA Free

Western Blot: TINAGL1 Antibody [NBP1-57765] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: TINAGL1 Antibody [NBP1-57765] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: TINAGL1 Antibody [NBP1-57765] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TINAGL1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TINAGL1 (tubulointerstitial nephritis antigen-like 1) The peptide sequence was selected from the middle region of TINAGL1)(50ug). Peptide sequence NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TINAGL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TINAGL1 Antibody - BSA Free

• androgen-regulated gene 1
• ARG1
• GIS5
• Glucocorticoid-inducible protein 5
• LCN7
• LIECG3
• lipocalin 7
• OLRG2
• OLRG-2
• Oxidized LDL-responsive gene 2 protein
• oxidized-LDL responsive gene 2
• P3ECSL
• TIN Ag-related protein
• TINAGL
• TINAGL1
• TINAG-like 1
• TINAGRP
• TIN-ag-RP
• tubulointerstitial nephritis antigen-like 1
• tubulointerstitial nephritis antigen-like
• Tubulointerstitial nephritis antigen-related protein

Background

TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TINAGL1
• Uniprot:
  • Q9GZM7(Human)