TIN-Ag Antibody

Images

 
Western Blot: TINAG Antibody [NBP1-86307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TINAG Antibody [NBP1-86307] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIN-Ag Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HTQPWYPEGCFKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRPELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TINAG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TIN-Ag Protein (NBP1-86307PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIN-Ag Antibody

  • TIN1
  • TIN2
  • TINAg
  • TIN-Ag
  • tubulointerstitial nephritis antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
MAB7185
Species: Hu
Applications: WB, Simple Western
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
H00004867-D01P
Species: Hu, Mu
Applications: WB
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-81826
Species: Hu
Applications: IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7475
Species: Hu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86307
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TIN-Ag Antibody (NBP1-86307) (0)

There are no publications for TIN-Ag Antibody (NBP1-86307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIN-Ag Antibody (NBP1-86307) (0)

There are no reviews for TIN-Ag Antibody (NBP1-86307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIN-Ag Antibody (NBP1-86307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIN-Ag Products

Bioinformatics Tool for TIN-Ag Antibody (NBP1-86307)

Discover related pathways, diseases and genes to TIN-Ag Antibody (NBP1-86307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIN-Ag Antibody (NBP1-86307)

Discover more about diseases related to TIN-Ag Antibody (NBP1-86307).
 

Pathways for TIN-Ag Antibody (NBP1-86307)

View related products by pathway.

PTMs for TIN-Ag Antibody (NBP1-86307)

Learn more about PTMs related to TIN-Ag Antibody (NBP1-86307).

Blogs on TIN-Ag

There are no specific blogs for TIN-Ag, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIN-Ag Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TINAG
Entrez