TIMP-3 Antibody - BSA Free

Western Blot: TIMP-3 Antibody [NBP1-69197] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Immunohistochemistry: TIMP-3 Antibody [NBP1-69197] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic in secretions between cells Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TIMP-3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TIMP3 (TIMP metallopeptidase inhibitor 3) The peptide sequence was selected form the middle region of TIMP3. Peptide sequence LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TIMP-3 Antibody - BSA Free

• HSMRK222
• K222
• K222TA2
• metalloproteinase inhibitor 3
• MIG-5 protein
• Protein MIG-5
• pseudoinflammatory)
• SFD
• TIMP metallopeptidase inhibitor 3
• TIMP3
• TIMP-3
• tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy
• Tissue inhibitor of metalloproteinases 3

Background

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMP3
• OMIM:
  • NP_000353(Human)
• Uniprot:
  • P48032(Human)