TIMM8B Antibody

Images

 
Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP1-84287] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIMM8B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TIMM8B Protein (NBP1-84287PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM8B Antibody

  • DDP2DDP-like protein
  • DDPL
  • Deafness dystonia protein 2
  • FLJ21744
  • MGC102866
  • MGC117373
  • mitochondrial import inner membrane translocase subunit Tim8 B
  • TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B
  • translocase of inner mitochondrial membrane 8 homolog B (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-84606
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2584
Species: Mu
Applications: WB, Simple Western
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP2-15548
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF

Publications for TIMM8B Antibody (NBP1-84287) (0)

There are no publications for TIMM8B Antibody (NBP1-84287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM8B Antibody (NBP1-84287) (0)

There are no reviews for TIMM8B Antibody (NBP1-84287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIMM8B Antibody (NBP1-84287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM8B Products

Bioinformatics Tool for TIMM8B Antibody (NBP1-84287)

Discover related pathways, diseases and genes to TIMM8B Antibody (NBP1-84287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM8B Antibody (NBP1-84287)

Discover more about diseases related to TIMM8B Antibody (NBP1-84287).
 

Pathways for TIMM8B Antibody (NBP1-84287)

View related products by pathway.

PTMs for TIMM8B Antibody (NBP1-84287)

Learn more about PTMs related to TIMM8B Antibody (NBP1-84287).
 

Research Areas for TIMM8B Antibody (NBP1-84287)

Find related products by research area.

Blogs on TIMM8B

There are no specific blogs for TIMM8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM8B