TIMM8B Antibody


Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP1-84287] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TIMM8B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
Specificity of human TIMM8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TIMM8B Protein (NBP1-84287PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TIMM8B Antibody

  • DDP2DDP-like protein
  • DDPL
  • Deafness dystonia protein 2
  • FLJ21744
  • MGC102866
  • MGC117373
  • mitochondrial import inner membrane translocase subunit Tim8 B
  • TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B
  • translocase of inner mitochondrial membrane 8 homolog B (yeast)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TIMM8B Antibody (NBP1-84287) (0)

There are no publications for TIMM8B Antibody (NBP1-84287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM8B Antibody (NBP1-84287) (0)

There are no reviews for TIMM8B Antibody (NBP1-84287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIMM8B Antibody (NBP1-84287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TIMM8B Products

Bioinformatics Tool for TIMM8B Antibody (NBP1-84287)

Discover related pathways, diseases and genes to TIMM8B Antibody (NBP1-84287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM8B Antibody (NBP1-84287)

Discover more about diseases related to TIMM8B Antibody (NBP1-84287).

Pathways for TIMM8B Antibody (NBP1-84287)

View related products by pathway.

PTMs for TIMM8B Antibody (NBP1-84287)

Learn more about PTMs related to TIMM8B Antibody (NBP1-84287).

Research Areas for TIMM8B Antibody (NBP1-84287)

Find related products by research area.

Blogs on TIMM8B

There are no specific blogs for TIMM8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIMM8B Antibody and receive a gift card or discount.


Gene Symbol TIMM8B