Pyruvate Dehydrogenase E2 Antibody

Images

 
Independent Antibodies: Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis using Anti-DLAT antibody NBP2-34065 (A) shows similar pattern to independent antibody NBP2-56744 (B).
Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human liver shows low expression as expected
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis in human heart muscle and liver tissues using Anti-DLAT antibody. Corresponding DLAT RNA-seq data ...read more
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human heart muscle shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pyruvate Dehydrogenase E2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)
Publications
Read Publication using
NBP2-34065 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyruvate Dehydrogenase E2 Antibody

  • 70 kDa mitochondrial autoantigen of primary biliary cirrhosis
  • dihydrolipoamide S-acetyltransferase
  • DLTA
  • E2 component of pyruvate dehydrogenase complex
  • EC 2.3.1
  • M2 antigen complex 70 kDa subunit
  • PBC
  • PDC-E2EC 2.3.1.12
  • PDCE2mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-93742
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
7268-CT
Species: Hu
Applications: BA
NBP2-32204
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065) (0)

There are no reviews for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pyruvate Dehydrogenase E2 Products

Bioinformatics Tool for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)

Discover related pathways, diseases and genes to Pyruvate Dehydrogenase E2 Antibody (NBP2-34065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)

Discover more about diseases related to Pyruvate Dehydrogenase E2 Antibody (NBP2-34065).
 

Pathways for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)

View related products by pathway.

PTMs for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)

Learn more about PTMs related to Pyruvate Dehydrogenase E2 Antibody (NBP2-34065).
 

Research Areas for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)

Find related products by research area.

Blogs on Pyruvate Dehydrogenase E2

There are no specific blogs for Pyruvate Dehydrogenase E2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Dehydrogenase E2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLAT
Uniprot