TIMM23 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TIMM23 Antibody [NBP1-80680] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: TIMM23 Antibody [NBP1-80680] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIMM23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL
Specificity
Specificity of human TIMM23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM23B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM23 Antibody

  • bA592B15.7
  • MGC22767
  • PRO1197
  • RP11-592B15.7
  • TIM23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001678-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46320
Species: Hu
Applications: WB, IHC
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NBP2-38791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98528
Species: Hu
Applications: WB
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5228
Species: Hu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
MAB5469
Species: Hu
Applications: WB, ICC
H00006690-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80680
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TIMM23 Antibody (NBP1-80680) (0)

There are no publications for TIMM23 Antibody (NBP1-80680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM23 Antibody (NBP1-80680) (0)

There are no reviews for TIMM23 Antibody (NBP1-80680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TIMM23 Antibody (NBP1-80680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIMM23 Products

Bioinformatics Tool for TIMM23 Antibody (NBP1-80680)

Discover related pathways, diseases and genes to TIMM23 Antibody (NBP1-80680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TIMM23.

New Players in the Mitophagy Game
By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al...  Read full blog post.

Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM23B
COVID-19 update