TIMM44 Antibody

Images

 
Genetic Strategies: Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Immunocytochemistry/ Immunofluorescence: TIMM44 Antibody [NBP1-86941] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.
Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Genetic Strategies: Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Orthogonal Strategies: Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Genetic Strategies: Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIMM44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
Specificity
Specificity of human TIMM44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-86941 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM44 Antibody

  • MIMT44
  • mitochondrial import inner membrane translocase subunit TIM44
  • mitochondrial inner membrane translocase
  • TIM44DKFZp686H05241
  • translocase of inner mitochondrial membrane 44 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt, Bv, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1750
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00131118-B01P
Species: Hu
Applications: WB, ELISA
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98528
Species: Hu
Applications: WB
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB

Publications for TIMM44 Antibody (NBP1-86941)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TIMM44 Antibody (NBP1-86941) (0)

There are no reviews for TIMM44 Antibody (NBP1-86941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMM44 Antibody (NBP1-86941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIMM44 Products

Bioinformatics Tool for TIMM44 Antibody (NBP1-86941)

Discover related pathways, diseases and genes to TIMM44 Antibody (NBP1-86941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM44 Antibody (NBP1-86941)

Discover more about diseases related to TIMM44 Antibody (NBP1-86941).
 

Pathways for TIMM44 Antibody (NBP1-86941)

View related products by pathway.

Research Areas for TIMM44 Antibody (NBP1-86941)

Find related products by research area.

Blogs on TIMM44

There are no specific blogs for TIMM44, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM44
Novus 100% Guarantee