TIMM22 Antibody - Azide and BSA Free

Western Blot: TIMM22 Antibody [NBP3-16088] - Western blot analysis of extracts of various cell lines, using TIMM22 antibody (NBP3-16088) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunoprecipitation: TIMM22 Antibody [NBP3-16088] - Immunoprecipitation analysis of 600ug extracts of Rat brain cells using 3ug TIMM22 antibody (NBP3-16088). Western blot was performed from the immunoprecipitate using TIMM22 antibody (NBP3-16088) at a dilition of 1:500.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM22 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TIMM22 Antibody - Azide and BSA Free (NBP3-16088) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2). AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMM22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:100 - 1:500
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TIMM22 Antibody - Azide and BSA Free

• mitochondrial import inner membrane translocase subunit Tim22
• putative membrane protein
• Testis-expressed sequence 4TIM22TEX4
• translocase of inner mitochondrial membrane 22 homolog (yeast)

Background

Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM22