TIM-3 Antibody


Western Blot: TIM-3 Antibody [NBP1-69154] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TIM-3 Antibody Summary

Synthetic peptides corresponding to HAVCR2 (hepatitis A virus cellular receptor 2) The peptide sequence was selected from the C terminal of HAVCR2. Peptide sequence IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAVCR2 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIM-3 Antibody

  • CD366
  • FLJ14428
  • HAVCR2
  • HAVcr-2
  • hepatitis A virus cellular receptor 2
  • kidney injury molecule-3
  • T cell immunoglobulin mucin 3
  • T cell immunoglobulin mucin-3
  • T-cell immunoglobulin and mucin domain-containing protein 3
  • TIM 3
  • TIM3 T-cell membrane protein 3
  • TIM3
  • TIM-3
  • TIMD-3
  • TIMD3KIM-3


HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for TIM-3 Antibody (NBP1-69154) (0)

There are no publications for TIM-3 Antibody (NBP1-69154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIM-3 Antibody (NBP1-69154) (0)

There are no reviews for TIM-3 Antibody (NBP1-69154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIM-3 Antibody (NBP1-69154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TIM-3 Products

Bioinformatics Tool for TIM-3 Antibody (NBP1-69154)

Discover related pathways, diseases and genes to TIM-3 Antibody (NBP1-69154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIM-3 Antibody (NBP1-69154)

Discover more about diseases related to TIM-3 Antibody (NBP1-69154).

Pathways for TIM-3 Antibody (NBP1-69154)

View related products by pathway.

PTMs for TIM-3 Antibody (NBP1-69154)

Learn more about PTMs related to TIM-3 Antibody (NBP1-69154).

Research Areas for TIM-3 Antibody (NBP1-69154)

Find related products by research area.

Blogs on TIM-3.

TIM-3, a critical immune checkpoint in HIV research
CD4+ T-helper cells (Th) are the white blood lymphocytes expressing surface glycoprotein antigen CD4. These T-helper cells play an important role in the adaptive immune system by releasing T cell cytokines that help other immune cells to suppress o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIM-3 Antibody and receive a gift card or discount.


Gene Symbol HAVCR2