Tight Junction Protein 1 Antibody - BSA Free

Western Blot: Tight Junction Protein 1 Antibody [NBP1-91621] - Tight Junction Protein 1 Antibody Rat Lung Lysate 1ug/ml Gel Concentration 6-18%

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Tight Junction Protein 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Intercellular Junctions/Tight Junction Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TJP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 190 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Tight Junction Protein 1 Antibody - BSA Free

• DKFZp686M05161
• MGC133289
• tight junction protein 1 (zona occludens 1)
• Tight junction protein 1
• tight junction protein ZO-1
• TJP1
• ZO1
• ZO-1
• zona occludens 1
• Zona occludens protein 1
• zonula occludens 1 protein
• Zonula occludens protein 1

Background

Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tight Junction Protein 1 Antibody (NBP1-91621)(1)

Publication using NBP1-91621

• Tsuda A, Donaghey TC, Konduru NV, et al. Age-Dependent Translocation of Gold Nanoparticles across the Air-Blood Barrier ACS Nano 2019-09-24 [PMID: 31397554] (WB, Rat)

Bioinformatics

• Gene Symbol: TJP1
• Uniprot:
  • NP_001099736(Rat)