Genetic Strategies: Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the ...read more
Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the ...read more
Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. Left image FH-i, right image Corr-FH-iHeps. All images were taken ...read more
Biological Strategies: Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in ...read more
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat ...read more
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in control (vector only transfected HEK293T lysate) and TJP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. ...read more
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. ICC/IF image submitted by a ...read more
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot analysis of function protein expression on primary human renal cortical epithelial cells challenged with cytokines. Primary human renal tubular ...read more
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The ...read more
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Differentiation of FH- & corr-FH-iPSCs into hepatocytes. a Representative pictures of cell morphology & immunostainings of the ...read more
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the ...read more
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the ...read more
Tight Junction Protein 1 Antibody - BSA Free Summary
Description
Novus Biologicals Rabbit Tight Junction Protein 1 Antibody - BSA Free (NBP1-85047) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-Tight Junction Protein 1 Antibody: Cited in 20 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Marker
Intercellular Junctions/Tight Junction Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TJP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in HeLa, separated by Size, antibody dilution of 1:20, apparent MW was 257 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Porcine and mouse reactivity reported from verified customer reviews.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Tight Junction Protein 1 Antibody - BSA Free
DKFZp686M05161
MGC133289
tight junction protein 1 (zona occludens 1)
Tight junction protein 1
tight junction protein ZO-1
TJP1
ZO1
ZO-1
zona occludens 1
Zona occludens protein 1
zonula occludens 1 protein
Zonula occludens protein 1
Background
Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Zonula Occludens (ZO) the Junction Scaffolding Proteins The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.