TIAF1 Antibody

Images

 
Immunohistochemistry-Paraffin: TIAF1 Antibody [NBP2-13430] Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIAF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYAD KCV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TIAF1 Protein (NBP2-13430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIAF1 Antibody

  • 12 kDa TGF-beta-1-induced antiapoptotic factor
  • KIAA0216
  • MAJN
  • molecule associated with Jak-3 N-terminal
  • MYO18A
  • MYSPDZ
  • SPR210
  • TGFB1-induced apoptotic factor 1
  • TGF-beta-1-induced antiapoptotic factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-79840
Species: Hu
Applications: WB (-), IP
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for TIAF1 Antibody (NBP2-13430) (0)

There are no publications for TIAF1 Antibody (NBP2-13430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIAF1 Antibody (NBP2-13430) (0)

There are no reviews for TIAF1 Antibody (NBP2-13430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIAF1 Antibody (NBP2-13430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIAF1 Products

Bioinformatics Tool for TIAF1 Antibody (NBP2-13430)

Discover related pathways, diseases and genes to TIAF1 Antibody (NBP2-13430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIAF1 Antibody (NBP2-13430)

Discover more about diseases related to TIAF1 Antibody (NBP2-13430).
 

Pathways for TIAF1 Antibody (NBP2-13430)

View related products by pathway.

PTMs for TIAF1 Antibody (NBP2-13430)

Learn more about PTMs related to TIAF1 Antibody (NBP2-13430).
 

Research Areas for TIAF1 Antibody (NBP2-13430)

Find related products by research area.

Blogs on TIAF1

There are no specific blogs for TIAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIAF1