THRAP3 Antibody - Azide and BSA Free

Western Blot: THRAP3 Antibody [NBP3-04324] -Analysis of lysates from HeLa cells, using THRAP3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: THRAP3 Antibody [NBP3-04324] -Human brain tissue using THRAP3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin:THRAP3 Antibody [NBP3-04324] - Mouse brain tissue using THRAP3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin:THRAP3 Antibody [NBP3-04324] -Rat brain tissue using THRAP3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

THRAP3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit THRAP3 Antibody - Azide and BSA Free (NBP3-04324) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 340-500 of human THRAP3 (NP_005110.2). GGAAYTKRYLEEQKTENGKDKEQKQTNTDKEKIKEKGSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSKVIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEELEEESFPERSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THRAP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 109 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for THRAP3 Antibody - Azide and BSA Free

• FLJ22082
• MGC133082
• MGC133083
• thyroid hormone receptor associated protein 3
• Thyroid hormone receptor-associated protein complex 150 kDa component
• thyroid hormone receptor-associated protein, 150 kDa subunit
• Trap150
• TRAP150thyroid hormone receptor-associated protein 3

Background

Thyroid hormone receptors (TRs) are ligand dependent members of the steroid/retinoic acid superfamily of transcription factors. The two genes encoding TRs identified to date, TR alpha and TR beta, have been mapped to human chromosomes 17 and 3, respectively. TRs bind to thyroid hormone response elements (TREs) with half site binding motifs in the orientation of palindromes, direct repeats, or inverted palindromes. The affinities of binding are both variable and influenced differentially by 3,5,3 triiodo L thyronine (T3). Thyroid hormones, through their interaction with the thyroid receptor (TR), effect metabolic processes, growth and development in many tissues by regulating the expression of genes for growth hormone, malic enzyme and several hepatic proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: THRAP3