THRAP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: THRAP3 Antibody [NBP2-57174] - Staining of human cell line SiHa shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THRAP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL
Specificity
Specificity of human THRAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THRAP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for THRAP3 Antibody

  • FLJ22082
  • MGC133082
  • MGC133083
  • thyroid hormone receptor associated protein 3
  • Thyroid hormone receptor-associated protein complex 150 kDa component
  • thyroid hormone receptor-associated protein, 150 kDa subunit
  • Trap150
  • TRAP150thyroid hormone receptor-associated protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IHC-Fr (-)
NB100-1704
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-57160
Species: Hu, Mu, Rt, Bv, Ca, GP
Applications: WB, IHC, IHC-P, KD
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP2-19626
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-55690
Species: Hu
Applications: WB, ICC/IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-77240
Species: Hu
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NB120-5908
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-59786
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
NB100-2466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P

Publications for THRAP3 Antibody (NBP2-57174) (0)

There are no publications for THRAP3 Antibody (NBP2-57174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THRAP3 Antibody (NBP2-57174) (0)

There are no reviews for THRAP3 Antibody (NBP2-57174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for THRAP3 Antibody (NBP2-57174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional THRAP3 Products

Bioinformatics Tool for THRAP3 Antibody (NBP2-57174)

Discover related pathways, diseases and genes to THRAP3 Antibody (NBP2-57174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THRAP3 Antibody (NBP2-57174)

Discover more about diseases related to THRAP3 Antibody (NBP2-57174).
 

Pathways for THRAP3 Antibody (NBP2-57174)

View related products by pathway.

PTMs for THRAP3 Antibody (NBP2-57174)

Learn more about PTMs related to THRAP3 Antibody (NBP2-57174).
 

Research Areas for THRAP3 Antibody (NBP2-57174)

Find related products by research area.

Blogs on THRAP3

There are no specific blogs for THRAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THRAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THRAP3