THRAP3 Antibody - BSA Free

Western Blot: THRAP3 Antibody [NBP1-86915] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: THRAP3 Antibody [NBP1-86915] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: THRAP3 Antibody [NBP1-86915] - Staining of human tonsil shows strong nuclear positivity in both germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: THRAP3 Antibody [NBP1-86915] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: THRAP3 Antibody [NBP1-86915] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: THRAP3 Antibody [NBP1-86915] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THRAP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THRAP3 Antibody - BSA Free (NBP1-86915) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFS
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THRAP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  THRAP3 Recombinant Protein Antigen (NBP1-86915PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for THRAP3 Antibody - BSA Free

• FLJ22082
• MGC133082
• MGC133083
• thyroid hormone receptor associated protein 3
• Thyroid hormone receptor-associated protein complex 150 kDa component
• thyroid hormone receptor-associated protein, 150 kDa subunit
• Trap150
• TRAP150thyroid hormone receptor-associated protein 3

Background

Thyroid hormone receptors (TRs) are ligand dependent members of the steroid/retinoic acid superfamily of transcription factors. The two genes encoding TRs identified to date, TR alpha and TR beta, have been mapped to human chromosomes 17 and 3, respectively. TRs bind to thyroid hormone response elements (TREs) with half site binding motifs in the orientation of palindromes, direct repeats, or inverted palindromes. The affinities of binding are both variable and influenced differentially by 3,5,3 triiodo L thyronine (T3). Thyroid hormones, through their interaction with the thyroid receptor (TR), effect metabolic processes, growth and development in many tissues by regulating the expression of genes for growth hormone, malic enzyme and several hepatic proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THRAP3