PCTP Antibody (1F9)

Images

 
Western Blot: PCTP Antibody (1F9) [H00058488-M01] - PCTP monoclonal antibody (M01), clone 1F9 Analysis of PCTP expression in K-562.
Western Blot: PCTP Antibody (1F9) [H00058488-M01] - Analysis of PCTP over-expressed 293 cell line, cotransfected with PCTP Validated Chimera RNAi ( Cat # H00058488-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: PCTP Antibody (1F9) [H00058488-M01] - Analysis of PCTP expression in transfected 293T cell line by PCTP monoclonal antibody (M01), clone 1F9.Lane 1: PCTP transfected lysate(24.8 KDa).Lane 2: ...read more
Sandwich ELISA: PCTP Antibody (1F9) [H00058488-M01] - Detection limit for recombinant GST tagged PCTP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCTP Antibody (1F9) Summary

Immunogen
PCTP (AAH12084, 1 a.a. ~ 215 a.a) full length recombinant protein with GST tag.MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIY RLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQY VKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDME GRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKG SKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY LKKT
Localization
Cytoplasmic
Specificity
PCTP - phosphatidylcholine transfer protein
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCTP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCTP Antibody (1F9)

  • PC-TP
  • phosphatidylcholine transfer protein
  • StARD2
  • STARD2StAR-related lipid transfer (START) domain containing 2
  • StAR-related lipid transfer protein 2
  • START domain-containing protein 2

Background

PCTP (Phosphatidylcholine transfer protein) is a soluble lipid binding protein and a member of the steroidogenic acute regulatory-related transfer (START) domain superfamily. It transfers phosphatidylcholine between membrane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-34132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCTP Antibody (H00058488-M01) (0)

There are no publications for PCTP Antibody (H00058488-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTP Antibody (H00058488-M01) (0)

There are no reviews for PCTP Antibody (H00058488-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCTP Antibody (H00058488-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCTP Products

Bioinformatics Tool for PCTP Antibody (H00058488-M01)

Discover related pathways, diseases and genes to PCTP Antibody (H00058488-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTP Antibody (H00058488-M01)

Discover more about diseases related to PCTP Antibody (H00058488-M01).
 

Pathways for PCTP Antibody (H00058488-M01)

View related products by pathway.

PTMs for PCTP Antibody (H00058488-M01)

Learn more about PTMs related to PCTP Antibody (H00058488-M01).

Blogs on PCTP

There are no specific blogs for PCTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCTP Antibody (1F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCTP
Entrez
OMIM
Uniprot