Th-POK Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Th-POK Antibody [NBP1-88077] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Staining of human cerebral cortex, liver, lymph node and small intestine using Anti-ZBTB7B antibody NBP1-88077 (A) shows similar protein distribution across tissues to independent antibody NBP1-88078 (B).

Analysis in human small intestine and liver tissues using HPA006811 antibody. Corresponding ZBTB7B RNA-seq data are presented for the same tissues.

Staining of human small intestine shows strong nuclear positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human lymph node shows strong nuclear positivity in a subset of non-germinal center cells.

Staining of human cerebral cortex shows no positivity in neurons as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Th-POK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Th-POK Antibody - BSA Free (NBP1-88077) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB7B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Th-POK Protein (NBP1-88077PEP)

Reactivity Notes

Mouse (82%), Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Th-POK Antibody - BSA Free

• c-Krox
• hcKroxc-Krox
• Krueppel-related zinc finger protein cKrox
• kruppel-related zinc finger protein hcKrox
• T-helper-inducing POZ/Krueppel-like factor
• ThPOK
• Th-POK
• ZBTB15
• ZBTB15zinc finger protein 67 homolog (mouse)
• ZBTB7B
• ZFP67
• zfp-67
• zinc finger and BTB domain containing 15
• zinc finger and BTB domain containing 7B
• Zinc finger and BTB domain-containing protein 15
• zinc finger and BTB domain-containing protein 7B
• Zinc finger protein 67 homolog
• Zinc finger protein 857B
• Zinc finger protein Th-POK
• ZNF857B
• ZNF857BDKFZp686G01254

Background

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Th-POK Antibody (NBP1-88077)(1)

Publication using NBP1-88077

• Bao C, Wang F, Wang X et al. ThPOK and Runx3 Regulate the Differentiation of CD4+CD8??+ IELs in Oral Lichen Planus Research Square 2023-10-10 (ICC/IF, IHC-P, Human)
  
  Details:
  IHC-P Dilution 1:50; ICC/IF Dilution 1:500

Review for Th-POK Antibody (NBP1-88077) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: SIJO CHEMMANNUR WB Mouse 05/05/2017

Summary

• Application: Western Blot
• Sample Tested: MEFs whole cell lysate
• Species: Mouse
• Lot: A91767

Bioinformatics

• Gene Symbol: ZBTB7B