TGN46 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS |
| Marker |
TGN Marker |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TGOLN2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TGN46 Antibody - BSA Free
Background
The Trans-Golgi network integral membrane protein 2 (TGOLN2) was designated TGN46 based on the predicted molecular mass (46kDa). However, TGN46 is a heavily glycosylated protein, so its molecular weight is often detected at a 110-120kDa.
The TGN46 protein is widely expressed. It may be involved in regulating membrane traffic to and from trans-Golgi network, and has been reported as the best available marker for human trans-Golgi network.
TGN46 contains a luminal domain, a membrane-spanning domain, and a cytoplasmic domain. The membrane-spanning and cytoplasmic domains contain the retention and retrieval signals, respectively, for localization in the TGN.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for TGN46 Antibody (NBP1-86948) (0)
There are no publications for TGN46 Antibody (NBP1-86948).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TGN46 Antibody (NBP1-86948) (0)
There are no reviews for TGN46 Antibody (NBP1-86948).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TGN46 Antibody (NBP1-86948) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TGN46 Products
Research Areas for TGN46 Antibody (NBP1-86948)
Find related products by research area.
|
Blogs on TGN46