TGN46 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TGN46 Antibody [NBP1-86948] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: TGN46 Antibody [NBP1-86948] - Staining of human cerebral cortex, colon, kidney and testis using Anti-TGOLN2 antibody NBP1-86948 (A) shows similar protein distribution across tissues to independent antibody NBP1-86949 (B).

Immunohistochemistry-Paraffin: TGN46 Antibody [NBP1-86948] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: TGN46 Antibody [NBP1-86948] - Staining of human kidney.

Immunohistochemistry-Paraffin: TGN46 Antibody [NBP1-86948] - Staining of human testis.

Immunohistochemistry-Paraffin: TGN46 Antibody [NBP1-86948] - Staining of human colon.

Analysis in control (vector only transfected HEK293T lysate) and TGOLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TGN46 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TGN46 Antibody - BSA Free (NBP1-86948) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS
• Marker: TGN Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGOLN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TGN46 Protein (NBP1-86948PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TGN46 Antibody - BSA Free

• TGN 46
• TGN 48
• TGN 51
• TGN38 homolog
• TGN38
• TGN-38
• TGN46
• TGN-46
• TGN48
• TGN51
• TGOLN 2
• TGOLN2
• trans golgi network 38
• trans golgi network 46
• Trans Golgi network integral membrane protein 2 [Precursor]
• Trans Golgi network integral membrane protein 2
• Trans Golgi network protein (46 48 51kD isoforms)
• Trans golgi network protein 2
• Trans Golgi network protein TGN51
• Trans-Golgi network integral membrane protein 2
• Trans-Golgi network protein 2
• Trans-Golgi network protein TGN51
• TTGN 2
• TTGN2

Background

The Trans-Golgi network integral membrane protein 2 (TGOLN2) was designated TGN46 based on the predicted molecular mass (46kDa). However, TGN46 is a heavily glycosylated protein, so its molecular weight is often detected at a 110-120kDa. The TGN46 protein is widely expressed. It may be involved in regulating membrane traffic to and from trans-Golgi network, and has been reported as the best available marker for human trans-Golgi network. TGN46 contains a luminal domain, a membrane-spanning domain, and a cytoplasmic domain. The membrane-spanning and cytoplasmic domains contain the retention and retrieval signals, respectively, for localization in the TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGOLN2