TGN46 Antibody (9G5X6)

Images

 
Western Blot: TGN46 Antibody (9G5X6) [NBP3-15817] - Western blot analysis of extracts of HeLa cells, using TGN46 Rabbit mAb (NBP3-15817) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: TGN46 Antibody (9G5X6) [NBP3-15817] - Immunofluorescence analysis of U-2 OS cells using TGN46 Rabbit mAb (NBP3-15817) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Immunohistochemistry-Paraffin: TGN46 Antibody (9G5X6) [NBP3-15817] - Immunohistochemistry of paraffin-embedded human liver using TGN46 Rabbit mAb (NBP3-15817) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
9G5X6
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TGN46 Antibody (9G5X6) Summary

Description
Observed MW 90-100kDa Calculated MW-46kDa
Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TGN46 (O43493). MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGA
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
TGOLN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TGN46 Antibody (9G5X6)

  • TGN 46
  • TGN 48
  • TGN 51
  • TGN38 homolog
  • TGN38
  • TGN-38
  • TGN46
  • TGN-46
  • TGN48
  • TGN51
  • TGOLN 2
  • TGOLN2
  • trans golgi network 38
  • trans golgi network 46
  • Trans Golgi network integral membrane protein 2 [Precursor]
  • Trans Golgi network integral membrane protein 2
  • Trans Golgi network protein (46 48 51kD isoforms)
  • Trans golgi network protein 2
  • Trans Golgi network protein TGN51
  • Trans-Golgi network integral membrane protein 2
  • Trans-Golgi network protein 2
  • Trans-Golgi network protein TGN51
  • TTGN 2
  • TTGN2

Background

The Trans-Golgi network integral membrane protein 2 (TGOLN2) was designated TGN46 based on the predicted molecular mass (46kDa). However, TGN46 is a heavily glycosylated protein, so its molecular weight is often detected at a 110-120kDa. The TGN46 protein is widely expressed. It may be involved in regulating membrane traffic to and from trans-Golgi network, and has been reported as the best available marker for human trans-Golgi network. TGN46 contains a luminal domain, a membrane-spanning domain, and a cytoplasmic domain. The membrane-spanning and cytoplasmic domains contain the retention and retrieval signals, respectively, for localization in the TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1903
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
2914-HT
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-04024
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38528
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NBP2-92832
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-15817
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for TGN46 Antibody (NBP3-15817) (0)

There are no publications for TGN46 Antibody (NBP3-15817).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGN46 Antibody (NBP3-15817) (0)

There are no reviews for TGN46 Antibody (NBP3-15817). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TGN46 Antibody (NBP3-15817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TGN46 Products

Research Areas for TGN46 Antibody (NBP3-15817)

Find related products by research area.

Blogs on TGN46

There are no specific blogs for TGN46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGN46 Antibody (9G5X6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TGOLN2