Recombinant Human TGF-beta 1 Protein

Product Discontinued

Recombinant Human TGF-beta 1 Protein Summary

• Description: TGFB1 (Human) Recombinant Protein
  
  Source: E. coli
  
  Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Preparation Method: Escherichia coli expression system
• Details of Functionality: The activity is determined by the dose-dependent inhibition of IL-4-induced proliferation of mouse HT-2 cells. The expected ED50 for this effect is 0.1-0.15 ng/mL.
• Protein/Peptide Type: Recombinant Protein
• Gene: TGFB1

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for Func,SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized with 10 mM HCl, 50 ug BSA per mg/mL of protein.
• Preservative: No Preservative
• Reconstitution Instructions: Reconstitute with sterilized water to desired concentration.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TGF-beta 1 Protein

• CEDLAP
• DPD1
• latency-associated peptide
• TGF beta
• TGF beta1
• TGFB
• TGFB1
• TGF-beta 1 protein
• TGFbeta 1
• TGF-beta 1
• TGFbeta
• TGF-beta-1
• transforming growth factor beta-1
• transforming growth factor, beta 1

Background

TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGFB1