TFIIE-alpha Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TFIIE-alpha Antibody [NBP2-57280] - Staining of human cell line CACO-2 shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIIE-alpha Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMP
Specificity
Specificity of human TFIIE-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2E1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TFIIE-alpha Recombinant Protein Antigen (NBP2-57280PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TFIIE-alpha Antibody

  • FE
  • General transcription factor IIE 56 kDa subunit
  • general transcription factor IIE subunit 1
  • general transcription factor IIE, polypeptide 1 (alpha subunit, 56kD)
  • general transcription factor IIE, polypeptide 1, alpha 56kDa
  • TF2E1
  • TFIIE-A
  • TFIIE-alpha
  • Transcription initiation factor IIE subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF009
Species: Hu
Applications: WB, IHC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67279
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45552
Species: Hu
Applications: WB, IHC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008518-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TFIIE-alpha Antibody (NBP2-57280) (0)

There are no publications for TFIIE-alpha Antibody (NBP2-57280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIE-alpha Antibody (NBP2-57280) (0)

There are no reviews for TFIIE-alpha Antibody (NBP2-57280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TFIIE-alpha Antibody (NBP2-57280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TFIIE-alpha Products

Bioinformatics Tool for TFIIE-alpha Antibody (NBP2-57280)

Discover related pathways, diseases and genes to TFIIE-alpha Antibody (NBP2-57280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIE-alpha Antibody (NBP2-57280)

Discover more about diseases related to TFIIE-alpha Antibody (NBP2-57280).

Research Areas for TFIIE-alpha Antibody (NBP2-57280)

Find related products by research area.

Blogs on TFIIE-alpha

There are no specific blogs for TFIIE-alpha, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIE-alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2E1