TFAP4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TFAP4 Antibody [NBP1-89060] - Staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TFAP4 Antibody [NBP1-89060] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TFAP4 Antibody [NBP1-89060] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TFAP4 Antibody [NBP1-89060] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TFAP4 Antibody [NBP1-89060] - Staining of human skin shows weak nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFAP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFAP4 Antibody - BSA Free (NBP1-89060) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TFAP4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TFAP4 Protein (NBP1-89060PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFAP4 Antibody - BSA Free

• Activating enhancer-binding protein 4
• AP-4
• BHLHC41
• bHLHc41Class C basic helix-loop-helix protein 41
• transcription factor AP-4 (activating enhancer binding protein 4)
• transcription factor AP-4 (activating enhancer-binding protein 4)
• transcription factor AP-4

Background

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 (PubMed 2833704); Hu et al., 1990 (PubMed 2123466)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TFAP4 Antibody (NBP1-89060)(1)

Publication using NBP1-89060

• Jackstadt R, Roh S, Neumann J et al. AP4 is a mediator of epithelial-mesenchymal transition and metastasis in colorectal cancer. J Exp Med 2013-07-01 [PMID: 23752226]

Bioinformatics

• Gene Symbol: TFAP4