TFAP4 Antibody

Images

 
Western Blot: TFAP4 Antibody [NBP1-89060] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TFAP4 Antibody [NBP1-89060] - Staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: TFAP4 Antibody [NBP1-89060] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells and islet cells.
Western Blot: TFAP4 Antibody [NBP1-89060] - Analysis in human cell line SW620.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TFAP4 Protein (NBP1-89060PEP)
Publications
Read Publication using NBP1-89060.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23752226)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFAP4 Antibody

  • Activating enhancer-binding protein 4
  • AP-4
  • BHLHC41
  • bHLHc41Class C basic helix-loop-helix protein 41
  • transcription factor AP-4 (activating enhancer binding protein 4)
  • transcription factor AP-4 (activating enhancer-binding protein 4)
  • transcription factor AP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
AF6116
Species: Hu
Applications: WB, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NBP2-56456
Species: Hu
Applications: ICC/IF, IHC-P

Publications for TFAP4 Antibody (NBP1-89060)(1)

Reviews for TFAP4 Antibody (NBP1-89060) (0)

There are no reviews for TFAP4 Antibody (NBP1-89060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TFAP4 Antibody (NBP1-89060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFAP4 Products

Bioinformatics Tool for TFAP4 Antibody (NBP1-89060)

Discover related pathways, diseases and genes to TFAP4 Antibody (NBP1-89060). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFAP4 Antibody (NBP1-89060)

Discover more about diseases related to TFAP4 Antibody (NBP1-89060).
 

Pathways for TFAP4 Antibody (NBP1-89060)

View related products by pathway.

PTMs for TFAP4 Antibody (NBP1-89060)

Learn more about PTMs related to TFAP4 Antibody (NBP1-89060).

Blogs on TFAP4

There are no specific blogs for TFAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP4