TEX12 Antibody

Images

 
Western Blot: TEX12 Antibody [NBP2-32656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TEX12 Antibody [NBP2-32656] - Staining in human testis and prostate tissues using anti-TEX12 antibody. Corresponding TEX12 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry: TEX12 Antibody [NBP2-32656] - Analysis in human testis and prostate tissues using Anti-TEX12 antibody. Corresponding TEX12 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: TEX12 Antibody [NBP2-32656] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TEX12 Antibody [NBP2-32656] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TEX12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SKEINLMLSTYAKLLSERAAVDASYIDEIDELFKEANAIENFLIQKREFLRQRFTVIANTLHR
Specificity
Specificity of human TEX12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX12 Protein (NBP2-32656PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEX12 Antibody

  • testis expressed 12
  • testis expressed sequence 12
  • testis-expressed sequence 12 protein variant 2
  • testis-expressed sequence 12 protein variant 3
  • testis-expressed sequence 12 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88971
Species: Hu
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
NBP1-85401
Species: Hu
Applications: IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58087
Species: Hu, Mu
Applications: WB
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEX12 Antibody (NBP2-32656) (0)

There are no publications for TEX12 Antibody (NBP2-32656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX12 Antibody (NBP2-32656) (0)

There are no reviews for TEX12 Antibody (NBP2-32656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX12 Antibody (NBP2-32656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEX12 Products

TEX12 NBP2-32656

Bioinformatics Tool for TEX12 Antibody (NBP2-32656)

Discover related pathways, diseases and genes to TEX12 Antibody (NBP2-32656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX12 Antibody (NBP2-32656)

Discover more about diseases related to TEX12 Antibody (NBP2-32656).
 

Pathways for TEX12 Antibody (NBP2-32656)

View related products by pathway.

PTMs for TEX12 Antibody (NBP2-32656)

Learn more about PTMs related to TEX12 Antibody (NBP2-32656).

Blogs on TEX12

There are no specific blogs for TEX12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX12