ECH1 Antibody

Images

 
Western Blot: ECH1 Antibody [NBP1-83215] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: ECH1 Antibody [NBP1-83215] - Staining of mouse olfactory bulb shows positivity in the mitral cell layer.
Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cell bodies.
Western Blot: ECH1 Antibody [NBP1-83215] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ECH1 Antibody [NBP1-83215] - Staining of mouse caudate putamen shows positivity in neurons and blood vessels.
Immunocytochemistry/ Immunofluorescence: ECH1 Antibody [NBP1-83215] - Staining of mouse hippocampus shows immunoreactivity in the CA1 region.
Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human liver shows strong cytoplasmic positivity in a granular pattern in hepatocytes.
Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ECH1 Protein (NBP1-83215PEP)
Publications
Read Publications using NBP1-83215.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECH1 Antibody

  • delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
  • delta3,5-delta2,4-dienoyl-CoA isomerase
  • dienoyl-CoA isomerase
  • EC 5.3.3.-
  • enoyl CoA hydratase 1, peroxisomal
  • enoyl Coenzyme A hydratase 1, peroxisomal
  • HPXEL
  • peroxisomal enoyl-CoA hydratase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24669
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP1-02417
Species: Hu, Mu, Rt, Av, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ECH1 Antibody (NBP1-83215)(2)

Reviews for ECH1 Antibody (NBP1-83215) (0)

There are no reviews for ECH1 Antibody (NBP1-83215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ECH1 Antibody (NBP1-83215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECH1 Products

Bioinformatics Tool for ECH1 Antibody (NBP1-83215)

Discover related pathways, diseases and genes to ECH1 Antibody (NBP1-83215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECH1 Antibody (NBP1-83215)

Discover more about diseases related to ECH1 Antibody (NBP1-83215).
 

Pathways for ECH1 Antibody (NBP1-83215)

View related products by pathway.

PTMs for ECH1 Antibody (NBP1-83215)

Learn more about PTMs related to ECH1 Antibody (NBP1-83215).
 

Research Areas for ECH1 Antibody (NBP1-83215)

Find related products by research area.

Blogs on ECH1

There are no specific blogs for ECH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECH1