ECH1 Antibody - BSA Free

Immunohistochemistry: ECH1 Antibody [NBP1-83215] - Staining of mouse olfactory bulb shows positivity in the mitral cell layer.

Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human liver shows strong cytoplasmic positivity in a granular pattern in hepatocytes.

Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neurons.

Immunohistochemistry-Paraffin: ECH1 Antibody [NBP1-83215] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cell bodies.

Immunohistochemistry: ECH1 Antibody [NBP1-83215] - Staining of mouse caudate putamen shows positivity in neurons and blood vessels.

Immunohistochemistry: ECH1 Antibody [NBP1-83215] - Staining of mouse hippocampus shows immunoreactivity in the CA1 region.

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ECH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ECH1 Antibody - BSA Free (NBP1-83215) is a polyclonal antibody validated for use in IHC and WB. Anti-ECH1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ECH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ECH1 Protein (NBP1-83215PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ECH1 Antibody - BSA Free

• delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
• delta3,5-delta2,4-dienoyl-CoA isomerase
• dienoyl-CoA isomerase
• EC 5.3.3.-
• enoyl CoA hydratase 1, peroxisomal
• enoyl Coenzyme A hydratase 1, peroxisomal
• HPXEL
• peroxisomal enoyl-CoA hydratase 1

Background

ECH1 encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ECH1 Antibody (NBP1-83215)(2)

Publications using NBP1-83215

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: ECH1