STAG3 Antibody - BSA Free

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining in human testis and stomach tissues using anti-STAG3 antibody. Corresponding STAG3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human cerebral cortex, kidney, stomach and testis using Anti-STAG3 antibody NBP2-38851 (A) shows similar protein distribution across tissues to independent antibody NBP2-47258 (B).

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human kidney.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human stomach using Anti-STAG3 antibody NBP2-38851.

Immunohistochemistry-Paraffin: STAG3 Antibody [NBP2-38851] - Staining of human testis using Anti-STAG3 antibody NBP2-38851.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STAG3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STAG3 Antibody - BSA Free (NBP2-38851) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFHQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEGPAKPNREDVSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STAG3 Protein (NBP2-38851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STAG3 Antibody - BSA Free

• cohesin subunit SA-3
• SCC3 homolog 3
• stromal antigen 3stromalin 3
• stromalin-3

Background

Meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAG3
• Uniprot:
  • Q9UJ98(Human)