ID4 Antibody

Images

 
Western Blot: ID4 Antibody [H00003400-B01P] - Analysis of ID4 expression in transfected 293T cell line by ID4 polyclonal antibody. Lane 1: ID4 transfected lysate(17.71 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ID4 Antibody Summary

Immunogen
ID4 (NP_001537, 1 a.a. - 161 a.a.) full-length human protein. MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Specificity
ID4 - inhibitor of DNA binding 4, dominant negative helix-loop-helix protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ID4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature (PMID: 25778840).
Reviewed Applications
Read 1 Review rated 1
using
H00003400-B01P in the following applications:

Publications
Read Publications using
H00003400-B01P in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID4 Antibody

  • bHLHb27BHLHB27
  • Class B basic helix-loop-helix protein 27
  • DNA-binding protein inhibitor ID-4
  • IDB4
  • Inhibitor of DNA binding 4
  • inhibitor of DNA binding 4, dominant negative helix-loop-helix protein

Background

Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF6116
Species: Hu
Applications: WB, ICC
MAB2417
Species: Hu, Mu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56641
Species: Hu, Mu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for ID4 Antibody (H00003400-B01P)(2)

Review for ID4 Antibody (H00003400-B01P) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Opossum.
We have 1 review tested in 1 application: IHC-Fr.

Reviews using H00003400-B01P:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Opossum
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen ID4 H00003400-B01P
Enlarge
reviewed by:
Anonymous
IHC-Fr Opossum 01/05/2017
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedTestis
SpeciesOpossum

Comments

CommentsTested in gray short-tailed opossum (Monodelphis domestica) in testis from 8-month animal.
Tissue was fixed in 4% Paraformaldehyde overnight, incubated in 30% sucrose/PBS overnight and embedded in OCT. Sections were cut on a cryostat at 10um.

For immunofluorescence staining: Slides were dried 15 minutes, washed 3x3 min TBST (0.1% Triton X-100), permeabilized for 10 minutes in 2% Triton X-100 in TBS, rinsed 3x3 min TBST, blocked in 10% heat inactivated goat serum in TBST for 30 min, and primary added at 1:100 in 10% blocking solution. Slides were coverslipped with parafilm overnight at 4C. The next day slides were washed with TBST 4x5 min, secondaries (AlexaFluor 568 goat anti rabbit and AlexaFluor 488 goat anti mouse 1:500) for 1 hour, 3x3 washes TBST, and mounted with VectaShield HardSet (+ DAPI).

Intense staining at periphery of seminiferous tubules of Uchl-1 (red in image) with these conditions. 1:200 also worked though staining was less intense (not shown). The same conditions with 1% Triton X-100 for permeabiliziation resulted in weak staining at 1:100 and 1:200. However, ID-4 did not work well under any conditions. Shown in green is some faint staining in interstitial cells but this was not consistent between samples and did not appear to be specific. ID-4 was tested in 4 and 8 month opossum testes, and at dilutions ranging from 1:25 to 1:500. Single-antibody staining was also performed for each antibody and successful in Uchl-1, not ID-4.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID4 Antibody (H00003400-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ID4 Products

Bioinformatics Tool for ID4 Antibody (H00003400-B01P)

Discover related pathways, diseases and genes to ID4 Antibody (H00003400-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID4 Antibody (H00003400-B01P)

Discover more about diseases related to ID4 Antibody (H00003400-B01P).
 

Pathways for ID4 Antibody (H00003400-B01P)

View related products by pathway.

PTMs for ID4 Antibody (H00003400-B01P)

Learn more about PTMs related to ID4 Antibody (H00003400-B01P).

Blogs on ID4

There are no specific blogs for ID4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Anonymous
01/05/2017
Application: IHC-Fr
Species: Opossum

Bioinformatics

Gene Symbol ID4
Entrez
Uniprot