ID4 Antibody

Western Blot: ID4 Antibody [H00003400-B01P] - Analysis of ID4 expression in transfected 293T cell line by ID4 polyclonal antibody. Lane 1: ID4 transfected lysate(17.71 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

ID4 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ID4 (NP_001537, 1 a.a. - 161 a.a.) full-length human protein. MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
• Specificity: ID4 - inhibitor of DNA binding 4, dominant negative helix-loop-helix protein,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ID4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature (PMID: 25778840).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID4 Antibody

• bHLHb27BHLHB27
• Class B basic helix-loop-helix protein 27
• DNA-binding protein inhibitor ID-4
• IDB4
• Inhibitor of DNA binding 4
• inhibitor of DNA binding 4, dominant negative helix-loop-helix protein

Background

Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ID4 Antibody (H00003400-B01P)(3)

Publications using H00003400-B01P

• Ishikura Y, Yabuta Y, Ohta H et al. In Vitro Derivation and Propagation of Spermatogonial Stem Cell Activity from Mouse Pluripotent Stem Cells. Cell Rep 2017-12-06 [PMID: 27926879]
• Sharma P, Chinaranagari S, Chaudhary J. Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity. Biochimie. 2015-03-13 [PMID: 25778840] (ICC/IF, Human)
• Oatley MJ, Kaucher AV, Racicot KE, Oatley JM. Inhibitor of DNA binding 4 is expressed selectively by single spermatogonia in the male germline and regulates the self-renewal of spermatogonial stem cells in mice. Biol Reprod. 2011-05-04 [PMID: 21543770]

Review for ID4 Antibody (H00003400-B01P) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Opossum.

reviewed by: Verified Customer IHC-Fr Opossum 01/05/2017

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Testis
• Species: Opossum

Comments

• Comments: Tested in gray short-tailed opossum (Monodelphis domestica) in testis from 8-month animal.
  Tissue was fixed in 4% Paraformaldehyde overnight, incubated in 30% sucrose/PBS overnight and embedded in OCT. Sections were cut on a cryostat at 10um.
  
  For immunofluorescence staining: Slides were dried 15 minutes, washed 3x3 min TBST (0.1% Triton X-100), permeabilized for 10 minutes in 2% Triton X-100 in TBS, rinsed 3x3 min TBST, blocked in 10% heat inactivated goat serum in TBST for 30 min, and primary added at 1:100 in 10% blocking solution. Slides were coverslipped with parafilm overnight at 4C. The next day slides were washed with TBST 4x5 min, secondaries (AlexaFluor 568 goat anti rabbit and AlexaFluor 488 goat anti mouse 1:500) for 1 hour, 3x3 washes TBST, and mounted with VectaShield HardSet (+ DAPI).
  
  Intense staining at periphery of seminiferous tubules of Uchl-1 (red in image) with these conditions. 1:200 also worked though staining was less intense (not shown). The same conditions with 1% Triton X-100 for permeabiliziation resulted in weak staining at 1:100 and 1:200. However, ID-4 did not work well under any conditions. Shown in green is some faint staining in interstitial cells but this was not consistent between samples and did not appear to be specific. ID-4 was tested in 4 and 8 month opossum testes, and at dilutions ranging from 1:25 to 1:500. Single-antibody staining was also performed for each antibody and successful in Uchl-1, not ID-4.

Bioinformatics

• Gene Symbol: ID4
• Entrez:
  • 3400(Human)
• Uniprot:
  • NP_001537(Human)